KEGG   Pseudomonas aeruginosa M18: PAM18_3502
Entry
PAM18_3502        CDS       T01973                                 

Definition
(GenBank) hypothetical protein
  KO
K09792  uncharacterized protein
Organism
paf  Pseudomonas aeruginosa M18
Brite
KEGG Orthology (KO) [BR:paf00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    PAM18_3502
SSDB
Motif
Pfam: DsbD_2 DsbD
Other DBs
NCBI-ProteinID: AEO75985
Position
3895076..3895759
AA seq 227 aa
MAELAPLLVSALILGLLGGGHCLGMCGGLMGALTLAIPAEQRGRRLRLLLAYNLGRILSY
ACAGLLLGLAGWAVARTPLAGALRVVAGLLLIAMGLYLAGWWSGLTRVEALGRGLWRHLE
PFARRLLPVSSLPRALLLGAIWGWLPCGLVYSTLLWATSQGSALDSALLMLAFGLGTWPV
LLATGMAAERVTALLRRRGVRIVGGLMVILFGLWTLPGPHQAWLMGH
NT seq 684 nt   +upstreamnt  +downstreamnt
gtggctgaactggcgccgctgctggtttccgcgctgatcctcggcctgctcgggggaggc
cactgcctgggcatgtgcggcggcctgatgggcgccctgaccctggctattcccgccgaa
cagcgcggccgtcgtctgcgcctgctgctggcctacaacctcggccgcatcctcagctac
gcctgcgccggcctgctgctcggcctggccggctgggcagtggcgcgcaccccgttggcc
ggcgcgctgcgggtggtcgccgggctgctgctgatcgccatgggactctacctggccggc
tggtggagcggcctgacccgcgtcgaggcgctcggtcgcggcctctggcgccacctggaa
cccttcgcccggcgcctgctgccggtctccagcctgccacgggccctgctgctcggagcg
atctggggctggctgccctgcgggctggtctacagcaccctgctctgggccaccagccag
ggatcggcactggacagcgcgctgctgatgctggcgttcggcctcggcacctggccggtt
ctgctggccaccggcatggccgccgaacgggtgaccgccctgctgcgccgtcgcggcgta
cgcatcgtgggcggcctgatggtcatcctcttcggcctctggaccctcccaggaccgcac
caggcctggctgatggggcattga

DBGET integrated database retrieval system