KEGG   Pseudomonas aeruginosa M18: PAM18_3503
Entry
PAM18_3503        CDS       T01973                                 

Gene name
hemN
Definition
(GenBank) coproporphyrinogen III oxidase
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
paf  Pseudomonas aeruginosa M18
Pathway
paf00860  Porphyrin and chlorophyll metabolism
paf01100  Metabolic pathways
paf01110  Biosynthesis of secondary metabolites
Module
paf_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
Brite
KEGG Orthology (KO) [BR:paf00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PAM18_3503 (hemN)
Enzymes [BR:paf01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     PAM18_3503 (hemN)
SSDB
Motif
Pfam: Radical_SAM HemN_C
Other DBs
NCBI-ProteinID: AEO75986
Position
3895887..3897269
AA seq 460 aa
MLDTIRWDADLIRRYDLSGPRYTSYPTAVQFHEGIGPFDQLHALRDSRKAGHPLSLYVHI
PFCANICYYCACNKVITKDRGRSAPYLARLVREIEIVSRHLSREQVVEQLHFGGGTPTFL
SPGQLRELMSQLRTHLNLLDDDSGDYGIEIDPREADWSTMGLLRELGFNRVSLGVQDFDM
EVQKAVNRMQTPEETRTIVEAARTLQYRSINLDLIYGLPKQTPDSFARTVDEVIALQPDR
LSVFNYAHLPERFMPQRRINADDLPSPGQKLEMLQRTTEQLAAAGYRYIGMDHFALPDDE
LASAQEDGTLQRNFQGYTTHGHCDLVGLGVSAISQIGDLYSQNSSDINDYQTSLDNGQLA
IRRGLHCNSDDRVRRAVIQQLICHFELAFEDIETEFGIDFRSYFAELWPDLERFAADGLI
RLDAKGIDITSSGRLLVRSICMLFDRYLPSLNRQRFSRVI
NT seq 1383 nt   +upstreamnt  +downstreamnt
atgctcgacaccattcgctgggacgctgacctgattcggcgctacgacctttccggcccg
cgttacacctcctatccgaccgccgtgcagttccacgaaggcatcggcccgttcgaccag
ttgcacgccctgcgcgacagccggaaggccggacaccccctgtcgctctacgtgcacatc
ccgttctgcgccaacatctgctactactgcgcctgcaacaaggtgatcaccaaggatcgc
gggcgcagcgcgccgtaccttgcgcgcctggtccgcgagatcgagatcgtcagccgccac
ctctcccgcgagcaggtggtcgagcaactgcacttcggtggcggaaccccgaccttcctc
agtcccggccagttgcgcgaactcatgtcgcaattgcgcacccacctcaacctgctggac
gacgattcgggcgactacggcatcgagatcgacccgcgcgaggccgactggtcgaccatg
ggcctgctccgcgaactcggtttcaaccgcgtcagcctcggcgtacaggacttcgacatg
gaggtgcagaaggcggtcaaccgcatgcaaaccccggaggagacccgtaccatcgtcgag
gccgcgcgcaccctgcagtaccgctcgatcaacctcgacctgatctacggactgccgaaa
cagacgccggacagcttcgcccgcacggtcgacgaagtgatcgcgctacagccggatcgc
ctctcggtgttcaactacgcccacctgcccgagcgtttcatgccgcagcggcggatcaac
gccgacgacctgccgagcccgggccagaagctggaaatgctccagcgcaccaccgagcaa
ctcgccgcggcgggctaccgctatatcggcatggatcacttcgccctgcccgacgacgag
ctggccagcgcccaggaagacggcaccctgcaacgcaatttccagggctacaccacgcac
gggcactgtgacctggtaggtctcggggtctcggcgatcagccagatcggcgacctctac
agccagaacagcagcgacatcaacgactaccagaccagcctcgacaacggccagttggcg
atccgtcgcggcctgcactgcaacagcgacgaccgggtgcggcgcgcggtgatccagcaa
ctgatctgccacttcgaactggccttcgaggatatcgagacagagttcggcatcgacttc
cgcagttacttcgccgagctgtggcccgatctcgaacgcttcgccgccgacggcctgatc
cgcctggacgccaagggcatcgacatcacgtcttccggacgtctgctggtgcgttcgatc
tgcatgctgttcgaccgctacctgcccagcctcaaccggcagcgcttctcccgggtgatc
tga

DBGET integrated database retrieval system