KEGG   Pseudomonas aeruginosa M18: PAM18_3504
Entry
PAM18_3504        CDS       T01973                                 

Definition
(GenBank) hypothetical protein
Organism
paf  Pseudomonas aeruginosa M18
SSDB
Motif
Pfam: ABC_tran_CTD FapA ApoLp-III TBCC_N DUF4795 GHL13 Syntaxin_2 DUF713 DUF2203 ING YkyA DUF5398 LUC7 Latarcin TBCA Seryl_tRNA_N OmpH AAA_23 5_nucleotid TMPIT T3SS_needle_F FUSC
Other DBs
NCBI-ProteinID: AEO75987
Position
complement(3897318..3897785)
AA seq 155 aa
MLTLSGWITTQVPPSSRAAADAKAARTGTAEQAEDPAAGTDAADQHVQLSQAGRELAATM
GVPVEEEDEDIPQELRPMVKMIRELKKKIEEKLRELQEAMRSSDPGAKEARVPELQKELQ
QLNSALQTATAAMASAIKEMGISDPALIMKVMGSR
NT seq 468 nt   +upstreamnt  +downstreamnt
atgttgaccctcagtggctggatcaccacccaggtgccgccctcatcgcgcgccgccgcg
gacgccaaggccgcgcggaccggcaccgccgagcaggcggaagacccggccgccggcacc
gacgccgccgatcagcatgtacagctttcccaggcagggcgcgagctggccgctaccatg
ggggtgccggtggaggaggaggacgaggatatcccgcaggagttgcggccgatggtgaag
atgatccgcgagttgaagaagaagatcgaagagaagctcagggagctgcaggaggccatg
aggtcgtccgatccgggggcgaaggaggctcgcgtgcctgagttgcagaaggagctgcaa
caactcaactccgccctgcagacggcgacggcagcgatggcatcggccatcaaggagatg
ggcatcagcgacccggcgctgatcatgaaggtcatgggcagccggtag

DBGET integrated database retrieval system