KEGG   Pseudomonas aeruginosa M18: PAM18_3505
Entry
PAM18_3505        CDS       T01973                                 

Gene name
anr
Definition
(GenBank) transcriptional regulator Anr
  KO
K01420  CRP/FNR family transcriptional regulator, anaerobic regulatory protein
Organism
paf  Pseudomonas aeruginosa M18
Brite
KEGG Orthology (KO) [BR:paf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:paf03000]
    PAM18_3505 (anr)
Transcription factors [BR:paf03000]
 Prokaryotic type
  Helix-turn-helix
   CRP/FNR family
    PAM18_3505 (anr)
SSDB
Motif
Pfam: Crp cNMP_binding HTH_Crp_2 MarR
Other DBs
NCBI-ProteinID: AEO75988
Position
3898031..3898765
AA seq 244 aa
MAETIKVRALPQAHCKDCSLAPLCLPLSLTVEDMDSLDEIVKRGRPLKKGEFLFRQGDPF
GSVFAVRSGALKTFSITDAGEEQITGFHLPSELVGLSGMDTETYPVSAQALETTSVCEIP
FERLDELSEQLPQLRRQLMRLMSREIRDDQQMMLLLSKKTADERIATFLVNLSARFRARG
FSAQQFRLAMSRNEIGNYLGLAVETVSRVFTRFQQNGLISAEGKEVHILDSIELCALAGG
QLEG
NT seq 735 nt   +upstreamnt  +downstreamnt
atggccgaaaccatcaaggtgcgcgcactgccccaagcacactgcaaggattgcagtctg
gccccgctgtgcctccccctgtcgctgaccgtggaagacatggattcgctggacgagatc
gtcaagcgcggtcgtcccctgaagaaaggcgaattcctgttccgccagggcgatcctttc
ggctcggtctttgccgtgcgctccggcgccctgaaaaccttcagcatcaccgatgccggc
gaagagcagatcaccggcttccacctgcccagcgagctggtcggcctgtccgggatggat
accgagacctatccggtatccgcccaggctctggaaaccacctcggtctgcgagattccc
ttcgagcgcctggacgaactgtccgagcagctgccgcaactgcgccgtcaactgatgcgt
ctgatgagccgggaaatccgcgatgaccagcagatgatgctgctgctgtcgaagaagact
gccgacgagcgcatcgccaccttcctggtcaacctgtcggcgcgcttccgtgcccgcggc
ttctccgcccagcagttccgcctggccatgtcgcgcaacgagatcggcaactatctcggt
ctggccgtggaaaccgtgtcgcgggtcttcacccgcttccagcagaacggcctgatcagc
gcggaaggcaaggaagtgcacatcctcgactccatcgagctgtgcgccctcgccggcggc
cagttggaaggctga

DBGET integrated database retrieval system