KEGG   Pseudomonas aeruginosa M18: PAM18_3506
Entry
PAM18_3506        CDS       T01973                                 

Gene name
apt
Definition
(GenBank) adenine phosphoribosyltransferase
  KO
K00759  adenine phosphoribosyltransferase [EC:2.4.2.7]
Organism
paf  Pseudomonas aeruginosa M18
Pathway
paf00230  Purine metabolism
paf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paf00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    PAM18_3506 (apt)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:paf04147]
    PAM18_3506 (apt)
Enzymes [BR:paf01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.7  adenine phosphoribosyltransferase
     PAM18_3506 (apt)
Exosome [BR:paf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PAM18_3506 (apt)
SSDB
Motif
Pfam: Pribosyltran UPRTase
Other DBs
NCBI-ProteinID: AEO75989
Position
3898850..3899398
AA seq 182 aa
MIFDEFTLKSQIRAVPDFPKPGVVFRDITPLFQSPRALRMTVDSFVQRYIEADFSHIGAM
DARGFLIGSAVAYALNKPLVLFRKQGKLPADVLAEGYQTEYGEAFLEVHADSLCEGDSVL
IFDDLIATGGTLLAAASLVRRLGARVFEAAAIIDLPELGGSTRLQDAGISTFSLTAFALD
ER
NT seq 549 nt   +upstreamnt  +downstreamnt
atgattttcgacgagttcaccctcaagtcgcagatccgcgccgtgccggactttcccaag
cccggcgtggtgttccgcgacatcaccccgctgttccagtcgccgcgcgcgctgcgcatg
accgtggacagcttcgtccagcgctacatcgaggccgatttcagccacatcggcgccatg
gatgcccgtggcttcctcatcggctcggcggtggcctatgcgctgaacaagccgctggtc
ctgttccgcaagcagggcaagctgcccgccgacgtactcgccgagggctaccagaccgaa
tacggcgaggccttcctcgaagtacatgccgacagcctctgcgaaggcgacagcgtactg
atcttcgacgacctcatcgccaccggcgggaccctgctggcggccgcgagcctggtacga
cgcctcggggccagggtcttcgaggccgcggcgatcatcgacctgccggaactcggcggc
tccactcgcctgcaggacgccggcatctccaccttcagtctcaccgcgttcgctctcgac
gagcgttga

DBGET integrated database retrieval system