KEGG   Pseudomonas aeruginosa M18: PAM18_3507
Entry
PAM18_3507        CDS       T01973                                 

Definition
(GenBank) putative hydrolase
  KO
K07044  uncharacterized protein
Organism
paf  Pseudomonas aeruginosa M18
Brite
KEGG Orthology (KO) [BR:paf00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    PAM18_3507
SSDB
Motif
Pfam: Metal_hydrol
Other DBs
NCBI-ProteinID: AEO75990
Position
3899638..3900474
AA seq 278 aa
MTATGTASPVRANFPVRRMDFSFSETPKYWWDGQPFMTQFMNNLSSLFPYGEKFFVDSVR
AVRDRLEDPQLKKDVSAFIGQEAMHSKEHAAYNEYAEEHGVDLECLELRIKVLLENVSKV
TTRKHQLAITCALEHFTATMAAQLLKREDLTIQMQSPKMYKLWMWHAIEENEHKNVAYDV
YQKVYGGYFTRVLVMMLTTLMFFGVIGWFQLDLLRKDGQLFNWRSWKHGLGTLFGLRKGF
FTRLLLPYLDYYRPGFHPSDHDTAKLEKYWKDKLAFAD
NT seq 837 nt   +upstreamnt  +downstreamnt
atgactgccactggcaccgcctccccggttcgcgccaatttccccgtgcggcggatggat
ttcagcttcagcgaaaccccgaagtactggtgggacggccaacccttcatgacccagttc
atgaacaacctgtcctcgctcttcccctacggcgaaaaattcttcgtcgatagcgtacgc
gcggtgcgcgaccgcctggaggatccgcaactgaagaaggacgtcagtgccttcatcggc
caggaggcgatgcactccaaggagcatgccgcctacaacgaatatgccgaggagcacggg
gtcgacctggagtgcctcgaactgcggatcaaggtcctgctggaaaacgtcagcaaggtc
accaccaggaaacaccagttggcgatcacctgcgccctcgagcatttcaccgcgaccatg
gccgcgcagctgctcaagcgcgaagacctgaccatccagatgcagtcgccgaagatgtac
aagctgtggatgtggcatgccatcgaggagaacgaacacaagaatgtcgcctacgatgtg
taccagaaagtctacggcggctacttcacccgggttctggtgatgatgctgaccaccctg
atgttcttcggcgtcatcggctggttccagctcgacctgctacgcaaggacggccaattg
ttcaactggcgctcctggaagcatggcctgggcaccctgttcggcctgcgcaagggcttc
ttcacccgcctgctgctgccctacctggactactaccggccgggcttccaccccagcgac
cacgacaccgcgaaactggagaaatactggaaggacaaactggccttcgccgattga

DBGET integrated database retrieval system