KEGG   Pseudomonas aeruginosa M18: PAM18_4841Help
Entry
PAM18_4841        CDS       T01973                                 

Gene name
acsB
Definition
(GenBank) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
paf  Pseudomonas aeruginosa M18
Pathway
paf00010  Glycolysis / Gluconeogenesis
paf00620  Pyruvate metabolism
paf00640  Propanoate metabolism
paf00680  Methane metabolism
paf01100  Metabolic pathways
paf01110  Biosynthesis of secondary metabolites
paf01120  Microbial metabolism in diverse environments
paf01130  Biosynthesis of antibiotics
paf01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:paf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAM18_4841 (acsB)
   00620 Pyruvate metabolism
    PAM18_4841 (acsB)
   00640 Propanoate metabolism
    PAM18_4841 (acsB)
  Energy metabolism
   00680 Methane metabolism
    PAM18_4841 (acsB)
Enzymes [BR:paf01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     PAM18_4841 (acsB)
Lipid biosynthesis proteins [BR:paf01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   PAM18_4841 (acsB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AEO77321
Position
5368433..5370370
Genome map
AA seq 645 aa AA seqDB search
MFEISVHPVPDAVRQRAYLNDDDYQRLYRQSVENPDEFWGEQAKAFLDWFKPWHSVHHGD
LRKGQATWFKGGQLNVAYNCIDRHLERRGEQIAIVWEGDNPSESAHITYRKLHHNVCRLA
NVLKSRGVEKGDRVCIYMPMIPEAAYAMLACARIGAVHSVVFGGFSPDSLRDRILDADCR
TVITADEGVRGGKYIPLKQNVEKALKDCPDVSTVVVVERTQGDIPWVEGRDIWYHEALHA
ASADCPAEAMDAEDPLFILYTSGSTGKPKGVLHTTGGYLLGAAMTHKYVFDYHDGDVYWC
TADVGWVTGHSYIVYGPLANGATTLMFEGVPNYPDASRFWQVIDKHQVNIFYTAPTAIRA
LMREGDAPVRQTSRSSLRLLGSVGEPINPEAWEWYYQVVGEKRCPIVDTWWQTETGSILI
TPLPGATALKPGSATRPFFGVQPVLLDEKGKEIDGAGSGVLAIKASWPSQIRSVYGDHQR
MIDTYFKPYPGYYFSGDGARRDEDGYYWITGRVDDVINVSGHRIGTAEVESALVLHDAVA
EAAVVGCPHDVKGQAIYAFVTLMAGSQPSEALQQELLALVGKEIGSFAKPDHLQWAPSLP
KTRSGKIMRRILRKIACNELDSLGDTSTLADPGVVQGLIDNRLNR
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgttcgagatcagcgtccacccggtgccggacgccgtccgccagcgtgcctacctgaac
gacgacgactaccagcgcctgtaccgccaatccgtcgagaaccccgacgagttctggggc
gagcaggccaaggccttcctcgattggttcaagccctggcacagcgtccaccacggcgac
ctgaggaaaggccaggccacctggttcaagggcggccagttgaacgtcgcctacaactgc
atcgatcgccacctggaacgccgcggcgaacagatcgcgatcgtctgggaaggcgacaac
cccagcgaatccgcgcacatcacctaccgcaagctgcaccacaacgtctgccgcctggct
aacgtgctgaagagccgcggcgtggaaaagggcgaccgggtctgcatctacatgccgatg
attcccgaggccgcctacgccatgctcgcctgcgcccgtatcggggcggtgcactcggtg
gtgttcggcggcttctcgccggactcgctgcgcgaccgcatcctcgatgccgactgccgc
accgtgatcaccgccgacgagggcgtgcgcggcggcaagtacatcccgctgaagcagaat
gtggaaaaggcactgaaggactgcccggacgtctctaccgtggtggtggtcgagcgcacc
cagggcgacataccctgggtcgaaggccgcgacatctggtaccacgaggcgctccacgcg
gcctcagccgactgcccggcggaagcgatggacgccgaggacccgctgttcatcctctat
acctccggcagcaccggcaagccgaagggcgtgttgcacaccaccgggggctacctgctc
ggcgcggcgatgacccacaagtacgtgttcgactaccacgatggcgacgtctactggtgc
accgccgacgtcggctgggtcaccggacacagctatatcgtctacggcccgctggccaac
ggcgccaccaccctcatgttcgagggcgtgcccaactacccggacgcctcgcgcttctgg
caggtgatcgacaagcaccaggtgaatatcttctacaccgcgccgaccgcgatccgcgcg
ctgatgcgcgaaggcgacgccccggtccgccagacctcgcgcagcagcctgcgcctgctc
ggctcggtgggcgagccgatcaacccggaggcctgggagtggtactaccaggtggtcggc
gagaagcgctgccccatcgtcgatacctggtggcagaccgagaccggcagcatcctgatc
accccgttgcccggcgccactgcgctaaagccaggctcggctacccgcccgttcttcggc
gtgcaacccgtgctgctcgacgagaaaggcaaggaaatcgacggcgcgggcagcggcgta
ctggcgatcaaggccagttggccgagtcagatccgcagcgtctacggcgaccaccagcgg
atgatcgacacctacttcaagccctaccccgggtattacttcagcggcgacggcgcgcgc
cgcgacgaagacggctactactggatcaccggccgggtcgacgacgtgatcaatgtctcc
ggacaccggatcggcaccgccgaggtcgagagcgcgctggtcctgcacgatgcggtggcc
gaggcggcagtggtcggctgcccgcatgacgtgaagggccaggccatctacgcgttcgtc
accctgatggccggcagtcagcccagcgaggcgctacaacaggaattgctggccctggtc
ggcaaggagatcggcagcttcgccaagccggatcacctgcaatgggcgcccagcctgccg
aagacccgctccggcaagatcatgcggcgtatcctgcgcaagatcgcctgcaacgagctg
gacagtctcggcgatacctcgaccctggccgatccgggagtggtgcaggggttgatcgac
aaccgcctcaaccgctga

DBGET integrated database retrieval system