KEGG   Pseudomonas aeruginosa LESB58: PLES_00791
Entry
PLES_00791        CDS       T00818                                 

Definition
(GenBank) hypothetical protein
  KO
K11892  type VI secretion system protein ImpK
Organism
pag  Pseudomonas aeruginosa LESB58
Pathway
pag03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pag00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PLES_00791
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pag02044]
    PLES_00791
Secretion system [BR:pag02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PLES_00791
SSDB
Motif
Pfam: DotU OmpA
Other DBs
NCBI-ProteinID: CAW24806
Structure
PDB: 
4B62

Position
complement(94135..95484)
AA seq 449 aa
MPPIDDPFGTPAGGGNGSPPDDRTMIMPRPGGRAPEPAGGPRGGDPYTPPPMASLAPLSG
RGDGLNPLEQAAGPLLAMLTRLRNTIAHPAPASLRAQLLGYLRQFEEKARQAGVAPDEVM
LARYVLCTALDEAVLSTPWGSTSDWGKQSLLITLHNEAWGGEKVFQLLEHCLQNPHQRLH
LLELLYLCTSLGFEGRYRVMHDGRSQLEALRERTAAVIRSTRGEYEHELSPHWRGLSVMR
DRLSQYLPPWVGIAIGLALLLALLFGLRMKLAADAEPVFKRIHAIGEIPVQAIDRPAVQP
RVIERPRLARFLADDIKAQRVAVEDAVDRSVVTIRGDELFASASASVRDEFQPLLLRIAD
ALRKVKGQVLVTGHSDNRPIATLRYPSNWKLSQARAQEVADLLGATTGDAGRFTAEGRSD
TEPVASNANAEGRARNRRVEITVFAEGAQ
NT seq 1350 nt   +upstreamnt  +downstreamnt
atgcctcccatcgacgatcccttcggcaccccggccggcggcggcaacggaagcccgccc
gacgaccgcaccatgatcatgccgcgtcccggcggccgcgccccggaaccggccggcggc
ccccgcggcggcgatccctacacgccgccgccgatggccagcctggcgccgctgagcggc
cgcggcgacggcctcaacccgctggagcaggccgccggcccactgctggcgatgctcacc
cgcctgcgcaacaccatcgcccatccggcgccggccagcctgcgcgcgcaactgctcggc
tacctgcgccagttcgaggagaaggcacgccaggccggcgtggcgccggacgaagtgatg
ctggcgcgctacgtgctctgcaccgccctcgacgaagcggtgctcagcacgccgtggggc
agcaccagcgactggggcaagcagagcctgctgatcaccctgcacaacgaggcctggggc
ggcgagaaggtcttccagttgctcgaacactgcctgcagaacccgcaccagcgcctgcac
ctgctggagctgctgtacctgtgcaccagcctcggcttcgaaggccgctaccgggtcatg
cacgacggccgcagccaactggaggcgctgcgcgagcgcaccgcggcggtgatccgcagc
acccgcggcgagtacgagcacgaactgtcgccgcactggcgcggcctcagcgtgatgcgc
gaccgcctttcgcaatacctgccgccgtgggtcggtatcgccatcggcctggccttgctg
ctggccttgctgttcggcctgcggatgaagctggccgccgacgccgagccggtgttcaag
cgcatccacgccatcggcgagatcccggtgcaggccatcgaccgcccggcggtgcagccg
cgggtgatcgagcggccacgcctggcgcgcttcctcgccgacgacatcaaggcccagcga
gtggcggtggaggacgccgtcgaccgctcggtggtgaccatccgcggcgacgagctgttc
gccagcgccagcgccagcgtgcgcgacgagttccagccgctgctgctgcgcatcgccgac
gccctgcgcaaggtcaagggccaggtgctggtcaccggccatagcgacaaccggccgatc
gccacgctgcgctacccgtccaactggaaactgtcccaggcccgcgcccaggaggtcgcc
gacctgctcggcgcgaccaccggcgacgccggccgcttcaccgccgaagggcgcagcgac
accgagccggtggcgagcaacgccaacgccgaaggccgcgcacgcaaccgccgggtggaa
atcaccgtattcgcggagggcgcgcaatga

DBGET integrated database retrieval system