KEGG   Pseudomonas aeruginosa LESB58: PLES_00811
Entry
PLES_00811        CDS       T00818                                 

Definition
(GenBank) putative lipoprotein
  KO
K11906  type VI secretion system protein VasD
Organism
pag  Pseudomonas aeruginosa LESB58
Pathway
pag03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pag00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PLES_00811
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pag02044]
    PLES_00811
Secretion system [BR:pag02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PLES_00811
SSDB
Motif
Pfam: T6SS-SciN
Other DBs
NCBI-ProteinID: CAW24808
Structure
PDB: 
3ZHN

Position
complement(96841..97305)
AA seq 154 aa
MQKLIVALFGLLLAACSSSPPETPPTRVVIWLHAAPNLNPSAAGQAAPLRLRLYELKKDT
AFGRADYFALTDNAQSTLGGDLVEQDEFLLRPGEERRIERTLDEQTRQLGFVAAYRDLDR
ATWRQVLDVPGQRTSHLDITLGAQAIGIVARPAP
NT seq 465 nt   +upstreamnt  +downstreamnt
atgcagaaactgatcgtcgcgctgttcgggctgctgctcgccgcctgttcgtccagcccg
ccggaaaccccgccgacccgggtggtgatctggctccacgccgcaccgaacctcaacccg
tccgccgccggccaggcggcgccgctgcgcctgcggctgtacgagctgaagaaagacacc
gcgttcggccgcgccgactacttcgccctcaccgacaacgcccagtcgaccctcggtggc
gacctggtggagcaggacgagttcctcctgcgtccgggcgaggaacggcgcatcgaacgc
acgctcgacgagcagacccgccagctcggtttcgtcgccgcctaccgcgacctcgaccgc
gccacctggcgccaggtcctcgacgtgccggggcaacgcaccagccatctcgacatcacg
ctcggcgcgcaggccatcggcatcgtcgcgcgtcccgcgccctga

DBGET integrated database retrieval system