KEGG   Pseudomonas aeruginosa LESB58: PLES_00851
Entry
PLES_00851        CDS       T00818                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11900  type VI secretion system protein ImpC
Organism
pag  Pseudomonas aeruginosa LESB58
Pathway
pag02025  Biofilm formation - Pseudomonas aeruginosa
Brite
KEGG Orthology (KO) [BR:pag00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    PLES_00851
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pag02044]
    PLES_00851
Secretion system [BR:pag02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PLES_00851
SSDB
Motif
Pfam: VipB VipB_2 TssC
Other DBs
NCBI-ProteinID: CAW24812
Structure
PDB: 
5N8N

Position
100859..102355
AA seq 498 aa
MAELSTENLAQGQTTTEQTSEFASLLLQEFKPKTERAREAVETAVRTLAEHALEQTSLIS
NDAIKSIESIIAAIDAKLTAQVNLIMHHADFQQLESAWRGLHYLVNNTETDEQLKIRVLN
ISKPELHKTLKKFKGTTWDQSPIFKKLYEEEYGQFGGEPYGCLVGDYYFDQSPPDVELLG
EMAKISAAMHAPFISAASPTVMGMGSWQELSNPRDLTKIFTTPEYAGWRSLRESEDSRYI
GLTMPRFLARLPYGAKTDPVEEFAFEEETDGADSSKYAWANSAYAMAVNINRSFKLYGWC
SRIRGVESGGEVQGLPAHTFPTDDGGVDMKCPTEIAISDRREAELAKNGFMPLLHKKNTD
FAAFIGAQSLQKPAEYDDPDATANANLAARLPYLFATCRFAHYLKCIVRDKIGSFKEKDE
MQRWLQDWILNYVDGDPAHSTETTKAQHPLAAAEVVVEEVEGNPGYYNSKFFLRPHYQLE
GLTVSLRLVSKLPSAKEA
NT seq 1497 nt   +upstreamnt  +downstreamnt
atggccgaattgagcaccgagaacctggcccagggccagaccaccaccgagcagaccagt
gagttcgccagcctgctgctgcaggagttcaagcccaagaccgagcgcgcccgcgaagcg
gtggagaccgccgtgcggaccctcgccgagcatgccctggagcagaccagcctgatctcc
aacgacgcgatcaagtcgatcgagtcgatcatcgcggcgatcgacgccaagctcaccgcg
caggtcaacctgatcatgcaccacgccgacttccagcaactggaaagcgcctggcgcggc
ctgcactacctggtcaacaacaccgagaccgacgagcaactgaagatccgcgtgctgaac
atctccaagccggagctgcacaagaccctgaagaaattcaagggcaccacctgggaccag
agcccgatcttcaagaagctctacgaagaggaatacggccagttcggcggcgagccctat
ggctgcctggtcggcgactactacttcgaccagtcgccgccggacgtcgagctgctcggc
gagatggcgaagatctccgccgccatgcacgcgccgttcatttccgccgcctcgccgacg
gtgatgggcatgggttcctggcaggaactgtccaacccgcgcgacctgaccaagatcttc
accaccccggaatacgccggctggcgttcgctgcgcgagtccgaggactcccgctacatc
ggcctgaccatgccgcgcttcctggcgcgcctgccctacggggcgaagaccgatccggtg
gaagagttcgccttcgaggaagaaaccgacggcgccgacagcagcaagtacgcctgggcc
aactcggcctacgcgatggcggtcaacatcaaccgctccttcaagctctacggctggtgc
tcgcggatccgcggcgtcgagtccggcggcgaggtgcagggcctgccggcgcacaccttc
cccaccgacgacggcggcgtggacatgaagtgcccgaccgagatcgccatttccgaccgc
cgcgaggcggagctggcgaagaacggcttcatgccgctgctgcacaagaagaacaccgac
ttcgccgccttcatcggcgcgcagtcgctgcagaaacccgccgagtacgacgatccggac
gccaccgccaacgccaacctggcggcgcgcctgccctacctgttcgccacctgccgcttc
gcccattacctgaagtgcatcgttcgcgacaagatcggttccttcaaggagaaggacgag
atgcagcgctggctgcaggactggatcctcaactacgtcgacggcgacccggcccactcc
accgagaccaccaaggcccagcacccgctggcggcggccgaagtggtggtggaggaagtc
gaaggcaatccgggttactacaactcgaagttcttccttcgcccgcactaccagctcgag
ggactgacggtatcgctacgcctggtatccaagctgccttcggccaaagaggcctga

DBGET integrated database retrieval system