KEGG   Pseudomonas aeruginosa LESB58: PLES_00861
Entry
PLES_00861        CDS       T00818                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
pag  Pseudomonas aeruginosa LESB58
Pathway
pag02025  Biofilm formation - Pseudomonas aeruginosa
pag03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pag00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PLES_00861
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    PLES_00861
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pag02044]
    PLES_00861
Secretion system [BR:pag02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PLES_00861
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: CAW24813
Structure
PDB: 
1Y12

Position
102431..102919
AA seq 162 aa
MAVDMFIKIGDVKGESKDKTHAEEIDVLAWSWGMSQSGSMHMGGGGGAGKVNVQDLSFTK
YIDKSTPNLMMACSSGKHYPQAKLTIRKAGGENQVEYLIITLKEVLVSSVSTGGSGGEDR
LTENVTLNFAQVQVDYQPQKADGAKDGGPVKYGWNIRQNVQA
NT seq 489 nt   +upstreamnt  +downstreamnt
atggctgttgatatgttcatcaagatcggcgacgtcaagggtgagtccaaggacaagact
cacgccgaggaaatcgacgtgctggcatggagctggggcatgtcccagtccgggtcgatg
cacatgggcggtggcggcggcgccggcaaggtcaacgtgcaggacctgtcgttcaccaag
tacatcgacaagtccacgcccaacctgatgatggcctgctccagcggcaagcactatccg
caggcgaagctgaccatccgcaaggccggcggcgagaaccaggtcgagtacctgatcatc
accctgaaggaagtcctggtgtcctcggtgagcaccggcggcagcggtggcgaggatcgc
ctgaccgagaacgtgaccctgaacttcgcccaggtccaggtcgactaccagccgcagaag
gcggatggcgcgaaggacggcggtccggtcaagtacggctggaacatccgccagaacgtg
caggcctga

DBGET integrated database retrieval system