KEGG   Pseudomonas aeruginosa LESB58: PLES_00871
Entry
PLES_00871        CDS       T00818                                 

Definition
(GenBank) putative secretion protein
  KO
K11898  type VI secretion system protein ImpE
Organism
pag  Pseudomonas aeruginosa LESB58
Brite
KEGG Orthology (KO) [BR:pag00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pag02044]
    PLES_00871
Secretion system [BR:pag02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   PLES_00871
SSDB
Motif
Pfam: ImpE TPR_19 TPR_14 TPR_16 BTAD
Other DBs
NCBI-ProteinID: CAW24814
Structure
PDB: 
4UQX 4UQY 4UQZ

Position
103087..103932
AA seq 281 aa
MADPSFASGRLGSRLQGSIAMIAEELLRAGRLDDALKALQEQVRSQPSNATLRIFLFQLL
AVMGQWARAQNQLKVVGELDASALPMVQTYSTAIDCEALRREVFAGRLTPVILGQPAEWI
APLLQALSLDAEGHGEAAQALREQAFDAAPAVPGRIGEAPFAWLADADTRLGPVLEVIVN
GRYAWLPMSNLRSLKVEAPSDLRDLVWLPAELTLANGGATVALLPARYAETVEHGDDAAR
LGRKTEWLDSGLPVGQRLFVTDAGETALFDLRELDFEPTDA
NT seq 846 nt   +upstreamnt  +downstreamnt
atggccgacccttcattcgcatccgggcgcctgggctcccggctacagggaagtatcgcg
atgatcgccgaagaactgttgcgcgccgggcgcctggacgatgccttgaaagccttgcag
gaacaggtgcgcagccagccgtcgaacgctaccctgcggatcttcctgttccagctgctg
gccgtgatgggccagtgggcgcgggcgcagaaccagctcaaggtggtcggcgaactggat
gcctcggcgctgccgatggtacagacctactccaccgccatcgactgcgaggcgctgcgc
cgcgaggtgttcgccgggcgcctgacgccggtgatcctcggccagccggcggaatggatc
gcgccgctgttgcaggccctgagcctggacgccgaaggccatggcgaggccgcccaggcc
ctgcgcgagcaggccttcgacgccgcgccggcggtgcccgggcggatcggcgaagcgccg
ttcgcctggctggcggatgccgacacgcgcctcggcccggtgctcgaggtaatcgtcaac
ggtcgctatgcctggttgccgatgagcaacctgcgcagcctcaaggtcgaggcgccgagc
gacctgcgcgatctggtctggctgccggccgaactgaccctggccaacggtggcgccacc
gtcgcgctgctgccggcgcgctacgcggaaaccgtcgagcacggcgacgacgccgcgcgc
ctggggcgcaagaccgaatggctggacagcggcctgccggtcggccagcggctgttcgtc
accgatgccggcgagaccgcgctgttcgacctgcgtgaactggacttcgagccgacggac
gcctga

DBGET integrated database retrieval system