KEGG   Pseudomonas aeruginosa LESB58: PLES_00881
Entry
PLES_00881        CDS       T00818                                 

Definition
(GenBank) hypothetical protein
  KO
K11897  type VI secretion system protein ImpF
Organism
pag  Pseudomonas aeruginosa LESB58
Brite
KEGG Orthology (KO) [BR:pag00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pag02044]
    PLES_00881
Secretion system [BR:pag02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PLES_00881
SSDB
Motif
Pfam: GPW_gp25
Other DBs
NCBI-ProteinID: CAW24815
Position
103934..104443
AA seq 169 aa
MAELTLQERLQPSLLDRLTDDEPGNLKEAAERRVLTLNQLKASVLRDLAWLFNTTSLFDH
GPAARMPAGNSVLNYGLPALAGHTASSVDVHAIEALLTETIATFEPRIIRSSLRVRAQLL
PGEMDHNALSFEIEGDLWAEPAPLRLLLTTNLDLETGHVRVAQGERRRT
NT seq 510 nt   +upstreamnt  +downstreamnt
atggccgaactgaccctccaggagcgcctgcagccgtcgctgctcgaccgcctcaccgac
gacgagccgggcaacctcaaggaagccgcggagcgccgggtgctgaccctgaaccagctg
aaggcctcggtgctgcgcgacctggcgtggctgttcaacaccacttcgctgttcgaccac
ggccccgccgcacggatgccggccggcaactcggtgctcaactacgggctgccggcgctg
gccgggcacaccgcgtcgagcgtcgacgtgcatgccatcgaggcgctgctcaccgagacc
atcgccaccttcgagccgcgcatcatccgttcttcgttgcgggtgcgcgcgcaactgctg
cccggcgagatggaccacaacgccctgagcttcgagatcgagggcgacctctgggccgaa
ccggcgccgctgcgcctgctgctgaccaccaacctggacctggagaccggccacgtgcgc
gtcgcccagggcgagcggaggcgtacatga

DBGET integrated database retrieval system