KEGG   Pseudomonas aeruginosa LESB58: PLES_00931
Entry
PLES_00931        CDS       T00818                                 

Definition
(GenBank) hypothetical protein
Organism
pag  Pseudomonas aeruginosa LESB58
SSDB
Motif
Pfam: Tsi6
Other DBs
NCBI-ProteinID: CAW24820
Structure
PDB: 
4ZV0 4ZUY 5JTK

Position
complement(112103..112387)
AA seq 94 aa
MTPIEYIDRALALVVDRLARYPGYEVLLSAEKQLQYIRSVLLDRSLDRSALHRLTLGSIA
VKEFDETDPELSRALKDAYYVGIRTGRGLKVDLP
NT seq 285 nt   +upstreamnt  +downstreamnt
atgacacccatcgaatacatcgaccgcgctctggcgctggtcgtcgaccggctggcccgc
tatccgggatacgaggtcctgctgtccgcggaaaagcaattgcagtacatcaggtccgtc
ctgctcgaccgcagcctggatcgttccgcactgcaccggttgaccctcggcagcatcgcc
gtgaaggaattcgacgaaaccgacccggaactctccagggccctcaaggacgcctactac
gtcggtatacgcactggccgcggcctgaaagtcgatctgccctga

DBGET integrated database retrieval system