KEGG   Pseudomonas aeruginosa LESB58: PLES_06751
Entry
PLES_06751        CDS       T00818                                 

Gene name
rplN
Definition
(GenBank) 50S ribosomal protein L14
  KO
K02874  large subunit ribosomal protein L14
Organism
pag  Pseudomonas aeruginosa LESB58
Pathway
pag03010  Ribosome
Brite
KEGG Orthology (KO) [BR:pag00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    PLES_06751 (rplN)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:pag03011]
    PLES_06751 (rplN)
Ribosome [BR:pag03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    PLES_06751 (rplN)
  Bacteria
    PLES_06751 (rplN)
  Archaea
    PLES_06751 (rplN)
SSDB
Motif
Pfam: Ribosomal_L14
Other DBs
NCBI-ProteinID: CAW25402
UniProt: B7V654
Structure
PDB: 
6SPB 6SPD

Position
730450..730818
AA seq 122 aa
MIQTQSMLDVADNSGARRVMCIKVLGGSHRRYAGIGDIIKVTVKEAIPRGKVKKGQVMTA
VVVRTKHGVRRTDGSIIRFDGNAAVLLNNKQEPIGTRIFGPVTRELRTEKFMKIVSLAPE
VL
NT seq 369 nt   +upstreamnt  +downstreamnt
atgattcagactcaatccatgctcgatgtcgctgacaacagcggcgcgcgtcgtgtgatg
tgcatcaaggtgctcggcggttcccaccgccgttacgccggcatcggcgacatcatcaag
gtcaccgtcaaggaagcgattccgcgcggcaaagtgaagaagggccaggtcatgactgcc
gtggtcgttcgcaccaagcacggcgtacgtcgtaccgacggttccatcatccgcttcgac
ggcaacgccgccgtcctgctgaacaacaagcaggagccgatcggcacccgtatctttggg
ccagtgactcgtgaactccgtaccgagaagttcatgaagatcgtctcgctcgcccccgaa
gtgctgtaa

DBGET integrated database retrieval system