KEGG   Pseudomonas aeruginosa LESB58: PLES_15271
Entry
PLES_15271        CDS       T00818                                 

Definition
(GenBank) hypothetical protein
Organism
pag  Pseudomonas aeruginosa LESB58
SSDB
Other DBs
NCBI-ProteinID: CAW26255
Structure
PDB: 

Position
complement(1658324..1658767)
AA seq 147 aa
MKTVALILASLALLACTAESGVDFDKTLTHPNGLVVERPVGFDARRSAEGFRFDEGGKLR
NPRQLEVQRQDAPPPPDLASRRLGDGEARYKVEVEEDDGGSAGSEYRLWAAKPAGTRWIV
VSASEQSEDGEPTFALAWALLERARLQ
NT seq 444 nt   +upstreamnt  +downstreamnt
atgaagacagtcgccctgattctcgccagcctcgccctgctggcctgcaccgcggagtcc
ggggtggacttcgacaagaccctgacccacccgaacggcctggtggtggagcgccccgtc
ggcttcgacgcgcggcgcagcgccgagggcttccgcttcgacgaaggcggcaagctgcgc
aacccacgccaactggaggtccagcgccaggacgcgccgcccccgcccgacctggcgagc
aggcgcctgggcgacggcgaggcgcgctacaaggtagaggtagaggaagacgacggcggc
tccgcaggcagcgaataccgcctgtgggcagccaagccggcgggcacgcggtggatcgtg
gtcagcgccagcgagcagagcgaggatggcgaaccgaccttcgccctggcctgggcgctg
ctggagcgggccaggttgcagtga

DBGET integrated database retrieval system