KEGG   Pseudomonas aeruginosa LESB58: PLES_22991
Entry
PLES_22991        CDS       T00818                                 

Definition
(GenBank) hypothetical protein
Organism
pag  Pseudomonas aeruginosa LESB58
SSDB
Motif
Pfam: DUF3592
Other DBs
NCBI-ProteinID: CAW27026
Position
2470393..2470830
AA seq 145 aa
MTTSSGSRIGGLLHASLFSLLGLGLLLAGGFKTVERYHFLRTAQEAQGTVSALNAGGSHP
QIDFTSVSGERISYPQGGFIFGYQVGEPVRVLYEAGRPAASAIVDDAGALWGTSAFLCGF
GALFGIVGFRGLLGLRSSQPTSKGH
NT seq 438 nt   +upstreamnt  +downstreamnt
atgacgacctcttccggttcgcgtatcggcggacttcttcacgcttcccttttttccctg
ctcggactcggtctcctgctcgccggcggtttcaagaccgtcgagcggtaccatttcctg
cgtactgcgcaggaagcccaggggacggtcagcgccttgaatgccggcggttcgcatccg
cagatcgatttcaccagcgtttccggcgagcggatttcctatccccagggcggcttcatc
ttcggctaccaggtgggcgagccggttcgcgtcctctacgaggctgggcggccggcggcc
agcgcgatagtcgacgatgccggcgcgctctggggaaccagcgctttcctctgcggcttc
ggcgcactcttcggtattgtcgggttcaggggattgctgggcctgcgttcttcccaaccg
acctcaaaaggacattga

DBGET integrated database retrieval system