KEGG   Pseudomonas aeruginosa LESB58: PLES_24011
Entry
PLES_24011        CDS       T00818                                 

Definition
(GenBank) hypothetical protein
Organism
pag  Pseudomonas aeruginosa LESB58
SSDB
Motif
Pfam: DHR-2 Chrome_Resist
Other DBs
NCBI-ProteinID: CAW27128
Structure
PDB: 
3RQ9 4C18 3VPV 3STQ 5AKO

Position
complement(2579264..2579497)
AA seq 77 aa
MNLKPQTLMVAIQCVAARTRELDAQLQNDDPQNAAELEQLLVGYDLAADDLKNAYEQALG
QYSGLPPYDRLIEEPAS
NT seq 234 nt   +upstreamnt  +downstreamnt
atgaacctgaaaccccagaccctgatggtggcgatccagtgcgtcgccgcgcgcacccgc
gaactcgacgcgcagttgcagaacgacgacccgcagaacgccgctgaactcgaacagttg
ctggtcggctacgacctcgccgccgacgacctgaagaacgcctacgagcaagccctgggc
caatacagcggcctgccgccctatgaccggctgatcgaagagccggcatcctga

DBGET integrated database retrieval system