KEGG   Pseudomonas aeruginosa LESB58: PLES_24191
Entry
PLES_24191        CDS       T00818                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
pag  Pseudomonas aeruginosa LESB58
Pathway
pag03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pag00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PLES_24191
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pag02044]
    PLES_24191
Secretion system [BR:pag02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PLES_24191
SSDB
Motif
Pfam: Phage_GPD Phage_base_V Gp5_C DUF2345
Other DBs
NCBI-ProteinID: CAW27146
Position
2598904..2601084
AA seq 726 aa
MAIGQPFATALGCTIIWRAAGALFGPPAAGDYQGRFPMLFSQHTRLVHVDSPLGPEVLQL
QRLEGREELGRLFSHELELVSSNPALPLDALLGKPMSLALELPGGSRRYFHGIVARCSQG
AGAGQFASYQVTLRPWLWLLTRTSDCRIFQNQKVPDIIKQVFRDLGFSDFEDALSRSYRE
WEYCVQYRETSFDFVSRLMEQEGIYYWFRHEKKRHILVLSDAYGAHHSPAGYTSVPYYPP
SLGHRERDHFFDWHMAREVQPGSLSLNDYDFQRPGTRLEVRSNVGRAHAAADYPLYDYPG
EYVQSQDGEHYARTRIEAIQTQYERVRLRGCARGIGAGHLFHLSNYPRLDQNREYLVVGA
EYRVVQELYETGNGGGGAQFESELDCIDAGQAFRPLPSTPVPVVRGPQTAVVVGPKGEEI
WTDQYGRVKVHFHWDRHDQSNENSSCWMRVSQAWAGKNWGSIQIPRIGQEVIVSFLEGDP
DRPIITGRVYNAEQTVPYELPANATQSGTKSRSSKGGTPANFNEIRMEDKKGAEQLFIHA
ERNQDIEVENDETHWVGHDRTKTIDHDETVHVKHDRTETVDNNETITVHANRSKTVDRNE
TVRIGMNKTETILMASLQNVGMGRMENVGLGYSLNVGMMMNTVVGLNQSTQVMKKKTLSV
GDSYEVSVGGSDDGSKITLDGQSITLGSQRIELTADREILLRCGQSTIRLTPGEIEILSP
NVDINC
NT seq 2181 nt   +upstreamnt  +downstreamnt
gtggctattggccagcctttcgcgacggcactgggttgtacgatcatctggcgcgctgct
ggcgcgttgttcgggccgcccgccgcaggtgactatcaaggaagattccccatgctgttc
tcccaacacacccgcctggtacacgtggactccccgctgggacccgaggtcctgcaactg
caacggctggagggtcgcgaagagctgggccggctgttcagccacgagctcgaactggtc
tcgagcaatcccgccttgcctctggatgccctgttgggcaagccgatgagcctcgcgctg
gaactccccggcggcagccggcggtatttccacggcatcgtcgcgcgctgtagccagggc
gccggcgccggccagttcgccagctaccaggtcaccctgcggccctggctgtggctgctg
acgcgcacctccgactgccgcatcttccagaaccagaaggtcccggacatcatcaagcag
gtgttccgcgaccttggcttctccgacttcgaggacgccctgagccgctcctaccgcgag
tgggaatactgtgtgcaataccgcgagaccagcttcgatttcgtcagccggctgatggag
caggaaggcatctactactggttccgccacgaaaagaagcgccacatcctggtgctctcc
gatgcctacggcgcgcaccacagcccggccggctacacaagcgtgccctattacccgccg
agcctcggccatcgcgagcgcgaccacttcttcgactggcacatggcgcgcgaggtccag
cccggctcgctaagcctcaacgactacgacttccagcgtcccggcacccgcctggaagtg
cgctccaatgtcgggcgcgcccatgccgcggccgactacccgctctacgactaccctggc
gagtatgtgcagagccaggacggcgaacactatgcacggacccgcatcgaggcgatccag
acccagtacgagcgagttcgcctgcggggatgcgccaggggtatcggggcgggccatctg
ttccacctgagcaactacccgcgcctggaccagaaccgcgaatacctggtggttggcgcc
gagtaccgggtagtccaggaactctacgagaccggtaatggcgggggcggcgcgcagttc
gagagcgagctggactgtatcgacgccggccaggctttccgccccttgccgtcgaccccg
gtgccggtggtgcgcggcccgcagaccgcggtggtggtcgggcccaagggcgaggagatc
tggaccgaccagtatggccgggtcaaggtgcatttccactgggaccgccacgaccagtcc
aacgagaacagctcctgctggatgcgcgtctcgcaggcctgggccgggaagaactggggc
tcgatccagatcccgcggatcggccaggaagtgatcgtcagcttcctcgaaggagacccg
gaccggccgatcatcaccgggcgggtctacaacgccgagcagacggtgccctacgagctg
ccggcgaacgctacccagagcggcaccaagagccgttcgagcaagggcggcacgccggcc
aacttcaacgagatccgcatggaggacaagaagggcgccgagcagttgttcatccatgcc
gagaggaaccaggacatcgaggtcgagaacgacgagacccactgggtcggccacgaccgg
accaagaccatcgaccacgacgagacggtgcatgtgaagcacgatcgcaccgagaccgtg
gacaacaacgagaccatcaccgtgcatgccaaccgcagcaagacggtcgaccgcaacgag
acggtcaggatcggcatgaacaagacggaaaccatcctcatggcctcgttgcagaacgtc
ggcatggggcgcatggaaaacgtcgggctcggctacagcctgaacgtcggcatgatgatg
aacaccgtggtcgggctgaaccagagcacccaggtgatgaagaagaagaccttgtcggtg
ggcgatagctacgaagtgagcgtgggcggcagcgacgatggctctaagatcaccctggac
ggtcagagcatcaccctcggcagccagcgcatcgagctgaccgccgaccgcgagatcctc
ttgcgctgcggccagagcacgatccgcctgacgccgggggagatcgagatcctctcgccc
aatgtcgatatcaactgttga

DBGET integrated database retrieval system