KEGG   Pseudomonas aeruginosa LESB58: PLES_26461Help
Entry
PLES_26461        CDS       T00818                                 

Definition
(GenBank) STY4579
Organism
pag  Pseudomonas aeruginosa LESB58
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TraG_N
Motif
Other DBs
NCBI-ProteinID: CAW27371
Position
complement(2842975..2844495)
Genome map
AA seq 506 aa AA seqDB search
MTLFTTDYLEYYLTLVSWIVNNGIWAVLVSSGVFALPFVAIVVQEWLKARAEGADEGNKG
VLSAARIENRVFVAIVVVMFAGIPFIDVDLSTIQYDSSRSAQCQVSVPQPTETGWSQSFS
TINNQSAKVPVWWAFMHALSRAVTSASVAAIPCGTDLRQMRMEIDATRIDDPVLAQEVAD
FSRDCYGPARAKLFMQRPDLDEQQMHDVTWIGSRFFTDTGGYYDSYRSSTAREAWPYDDT
RDAGLAQVANGGGYPTCRQWWSDGSNGLRARLLGQVDPTLLNRLAGWAGFLSRAEVDDSV
IRAIASPRQQKLNQGSVYTDYGGQIDKTLPNIVTRATGDVGMAVGAIAAFPAMDVVRQSL
PMILALLKMALVICIPLVLVVGTYDLKTVVTVSVVQFALFFTDFWFQLARWIDSTILDAL
YGWGFGWNRPHTNFDPLVGLNNAFGDMLLMFVMGTMFLVLPGFWLASLTWVGIRAGHVIQ
GLSDGSKSAGQAGGKGAGALTGGKLK
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgacgctcttcacgaccgactatctggagtactacctcaccctcgtgtcctggatcgtc
aacaacggtatctgggccgtgctggtgtccagcggggtgttcgcgctgcctttcgtcgcc
atcgtcgtgcaggagtggctgaaggcccgcgcggaaggcgctgacgagggcaacaaaggc
gttctgagtgccgcccgtatcgagaaccgggtgttcgtcgcgatcgtggtggtgatgttc
gcgggcattccgttcatcgacgtggacctcagcaccatccagtacgacagctcgcgctcg
gcgcagtgccaggtcagcgtgccgcagcccacggaaaccggctggtcgcagtccttcagc
accatcaacaaccagtcggcgaaggtgccggtctggtgggctttcatgcacgcgctctcg
cgcgccgtcacgagcgcctcggtagcggcgatcccgtgcggtacggacctgcggcagatg
aggatggagatcgacgcgacccgcattgacgacccggtactggctcaggaggtcgcggac
ttctcgcgggattgctatgggcctgcgcgggccaaattgttcatgcagcgcccggatctc
gatgagcagcagatgcacgacgtaacctggatcggctcgcgctttttcacggacacgggt
ggctactacgacagctaccgctccagcacggcgcgcgaggcatggccctatgacgacacc
cgcgatgcaggcctcgcgcaggttgccaatggtggcggctacccgacctgcaggcagtgg
tggtcagacggcagcaacggcctgcgcgcgcggctgctggggcaagtggacccgaccctg
ctgaatcgcctggcgggctgggccgggttcctcagccgggccgaggtggacgattcggtg
atccgcgccatcgcgtcaccgcggcagcagaaactgaaccagggcagcgtctatacggac
tacggcggccagatcgacaagaccctgccgaacatcgtgacgcgcgccacgggcgacgtg
gggatggcagtcggcgcgattgccgcgtttcctgccatggatgtcgtgcgccaatccctg
cccatgatcctcgccttactgaagatggcgctggtcatctgcatcccgctcgtgctggtt
gtgggcacctacgacctgaagacggtcgtcaccgtcagcgtcgtgcagttcgcgctgttc
ttcacggacttctggttccagctcgcacgctggatcgattcaacgattctggacgcgctt
tatggctggggctttggctggaaccggccgcacaccaactttgacccgctggtagggttg
aacaacgccttcggcgacatgctcctgatgttcgtcatgggcacgatgttcctggttctg
ccgggattctggctggcgagccttacctgggttgggattcgggccgggcacgtcatccag
ggactttccgatggcagcaagagcgccggccaagctggcggcaagggtgccggggcgctc
accggaggaaaactgaaatag

DBGET integrated database retrieval system