KEGG   Pseudomonas aeruginosa LESB58: PLES_27411Help
Entry
PLES_27411        CDS       T00818                                 

Definition
(GenBank) probable acyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pag  Pseudomonas aeruginosa LESB58
Pathway
pag00071  Fatty acid degradation
pag00072  Synthesis and degradation of ketone bodies
pag00280  Valine, leucine and isoleucine degradation
pag00310  Lysine degradation
pag00362  Benzoate degradation
pag00380  Tryptophan metabolism
pag00620  Pyruvate metabolism
pag00630  Glyoxylate and dicarboxylate metabolism
pag00640  Propanoate metabolism
pag00650  Butanoate metabolism
pag00900  Terpenoid backbone biosynthesis
pag01100  Metabolic pathways
pag01110  Biosynthesis of secondary metabolites
pag01120  Microbial metabolism in diverse environments
pag01130  Biosynthesis of antibiotics
pag01200  Carbon metabolism
pag01212  Fatty acid metabolism
pag02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PLES_27411
   00630 Glyoxylate and dicarboxylate metabolism
    PLES_27411
   00640 Propanoate metabolism
    PLES_27411
   00650 Butanoate metabolism
    PLES_27411
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PLES_27411
   00072 Synthesis and degradation of ketone bodies
    PLES_27411
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PLES_27411
   00310 Lysine degradation
    PLES_27411
   00380 Tryptophan metabolism
    PLES_27411
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PLES_27411
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PLES_27411
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PLES_27411
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pag04147]
    PLES_27411
Enzymes [BR:pag01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PLES_27411
Exosome [BR:pag04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PLES_27411
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CAW27468
Position
2942075..2943265
Genome map
AA seq 396 aa AA seqDB search
MTREDPIVIVSAVRTPMGGFLGDFKDVNAATLGAAAVRAAVERARLQADEVDEAVLGCVL
AAGQGQAPARQAVLGAGLARGTPCSTLNKMCGSGMKALMLAHDTLLAGSAGVALAGGMES
MSNAPYLLERARSGYRMGHGKVLDHMFLDGLEDAYDKGRLMGTFAEDCAEAYGFTREAQD
EFAVASLTRAQQAMRDGRFQAEIVPLTVTAGKTERLVDSDEQPPKARLDKIPTLKPAFRE
GGTVTAANSSSISDGAAALVLMRLSEAERRGLAPLAAIRGHASFADAPNLFPTAPVGAVK
RLMQRTGWSLGEVDLFEVNEAFAVVGMAAMRDLDLSHERLNVHGGACALGHPIGASGARI
VVTLLNALQQYDLERGVAAVCIGGGEATAIAVERLR
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcgaagatccgatcgtcatcgtcagcgccgtccgcaccccgatgggcggcttc
ctcggcgacttcaaggacgtcaacgccgctaccctcggtgccgcggcggtgcgcgccgcg
gtggagcgggcgcgcctgcaagccgacgaagtggacgaggccgtgctcggctgcgtgctc
gccgccggccagggccaggcgccggcgcgccaggcggtgcttggcgccggactggcgcgc
ggcacgccgtgctcgacgctgaacaagatgtgcggctcgggcatgaaggcgctgatgctc
gcccatgacacgttgctcgccggcagcgccggggtcgcgctggccgggggcatggaaagc
atgtccaacgcgccctacctgctggagcgcgcccgtagcggctaccgcatgggccacggc
aaggtgctcgaccacatgttcctcgacggcctcgaagacgcctacgacaagggccgcctg
atgggcaccttcgccgaggactgtgccgaagcctacggtttcacccgcgaagcacaggac
gagttcgccgtggcctcgctgacccgcgcgcagcaagccatgcgcgacgggcgcttccag
gccgagatcgtgccgctgacggtcaccgccggcaagaccgagcgcctggtggatagcgac
gagcagccgccgaaggcccggctggacaagatcccgaccctgaagccggcgttccgcgaa
ggcggcacggtgaccgcggccaactccagttcgatttccgacggcgccgccgcgctggtc
ctgatgcgcctttccgaggccgagcgacgcgggctcgcgccgttggcggcgattcgtggg
catgcttcgttcgccgacgcgccgaacctgttccccaccgcgccggtcggtgcggtgaag
cgcctgatgcagcgtaccggctggtcgctgggcgaggtcgacctgttcgaggtcaacgaa
gccttcgccgtggtcggcatggcggcaatgcgcgacctcgacctgtcccacgagcgcctc
aacgtccacggcggcgcctgtgcgctgggccatccgatcggcgcgtccggcgcgcggatc
gtcgtgaccctgctcaacgccctgcagcagtacgacctggaacgcggcgtggcggcggtc
tgcatcggcggcggcgaggcgaccgcgatcgccgtcgagcgcttgcgctga

DBGET integrated database retrieval system