KEGG   Pseudomonas aeruginosa LESB58: PLES_29431
Entry
PLES_29431        CDS       T00818                                 

Definition
(GenBank) hypothetical protein
  KO
K11902  type VI secretion system protein ImpA
Organism
pag  Pseudomonas aeruginosa LESB58
Pathway
pag02025  Biofilm formation - Pseudomonas aeruginosa
Brite
KEGG Orthology (KO) [BR:pag00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    PLES_29431
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pag02044]
    PLES_29431
Secretion system [BR:pag02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PLES_29431
SSDB
Motif
Pfam: ImpA_N ANTH
Other DBs
NCBI-ProteinID: CAW27670
Position
3237705..3238805
AA seq 366 aa
MTLPLSGNALSLEVLLEPIDPGQPCGPSLRYDPDYDRLRELRREDDSSLPTGVWQAEAKR
ADWAAVEQLASELLQRRSKDLMLAAWLGEAWLQRGGLGGLQRALVLLAELCERYPEEVHP
QAQDGDQSWRVPPIDWLLRRYAELLHTRLPLMGQGAFAEITLYAWQRLQRQQVASGDSKS
AKAALEAAQLQQKKLDEALRAEPLVQWQRKQASLLACQQQLLRLEQWCDRCLGELAPSCQ
PLREVIAQWLALLKEFIAMHPQAPLSEEQPPVAEADASEGDADGEESVPASAPSGPAGGP
TSREDAYRQLLLIADYLARTEPHSPVPYLIKRAVEWGNKPLSELLAELINADSEARRVWS
LLGVLP
NT seq 1101 nt   +upstreamnt  +downstreamnt
atgaccctgcctctttccggcaacgccctgtccctggaagtgctgctcgaaccgatcgac
cccggacagccgtgcggccccagcctgcgctacgacccggactacgaccgcctgcgcgag
ttgcgccgggaggacgacagcagcctgccgaccggcgtctggcaagcggaggccaagcgc
gccgactgggccgcggtggagcagttggccagcgaactgttgcagcggcgcagcaaggac
ctgatgctcgccgcctggctcggcgaggcctggctgcaacgcggcgggctgggcggattg
cagcgcgcgctggtgctgctggcggaactctgcgagcgctaccccgaggaggtgcatccg
caagcccaggacggcgaccagtcgtggcgggtgccgcccatcgactggctgttgcgccgc
tatgccgagctgctgcacacgcgcctgccgctgatggggcagggcgcgttcgccgagatc
accctctatgcctggcagaggttgcagcgccagcaggtcgccagcggcgacagcaagagc
gccaaggcggcgctggaagcggcgcaacttcagcagaagaagctagacgaagcgttgcgc
gcggagcccctggtgcaatggcagcgcaagcaggccagcctgctcgcctgccagcagcaa
ctactgcgcctggaacagtggtgcgaccgctgcctgggcgaactcgcccccagttgccag
ccattgcgcgaggtcatcgcgcaatggctggccttgctcaaggagttcatcgccatgcac
ccgcaagcgccgctgtccgaagaacagcccccggtcgcggaggcggatgccagcgaaggc
gacgcggacggcgaggaaagcgtcccggcgagcgcgccgagcgggccggctggcgggccg
accagtcgcgaggacgcctaccggcaattgctgctgatcgctgactacctggcgcgcacc
gagccgcacagcccggttccctacctgatcaagcgcgcggtggagtggggcaacaagccg
ctgagcgagttgctggcggagctgatcaatgcggactcggaggcgcgccgagtctggtcg
ctgcttggcgtactgccctaa

DBGET integrated database retrieval system