KEGG   Pseudomonas aeruginosa LESB58: PLES_35331Help
Entry
PLES_35331        CDS       T00818                                 

Gene name
folD
Definition
(GenBank) 5,10-methylene-tetrahydrofolate dehydrogenase / cyclohydrolase
  KO
K01491  methylenetetrahydrofolate dehydrogenase (NADP+) / methenyltetrahydrofolate cyclohydrolase [EC:1.5.1.5 3.5.4.9]
Organism
pag  Pseudomonas aeruginosa LESB58
Pathway
pag00670  One carbon pool by folate
pag01100  Metabolic pathways
pag01120  Microbial metabolism in diverse environments
pag01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pag00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    PLES_35331 (folD)
Enzymes [BR:pag01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.5  methylenetetrahydrofolate dehydrogenase (NADP+)
     PLES_35331 (folD)
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.9  methenyltetrahydrofolate cyclohydrolase
     PLES_35331 (folD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: THF_DHG_CYH_C THF_DHG_CYH OCD_Mu_crystall
Motif
Other DBs
NCBI-ProteinID: CAW28260
UniProt: B7VB83
Structure
PDB: 

Position
3921041..3921895
Genome map
AA seq 284 aa AA seqDB search
MTAQLIDGKAIAANLRQQIAQRVTERRQQGLRVPGLAVILVGTDPASQVYVAHKRKDCEE
VGFLSQAYDLPAETSQDDLLALIDRLNDDPAIDGILVQLPLPAHLDASLLLERIHPDKDV
DGFHPYNIGRLAQRMPLLRPCTPKGIMTLLASTGADLYGMDAVVVGASNIVGRPMALELL
LGGCTVTVTHRFTRDLADHVSRADLVVVAAGKPGLVKGEWIKEGAIVIDVGINRQADGRL
VGDVEYEVAAQRASWITPVPGGVGPMTRACLLENTLHAAEHLHD
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcacaactgatcgacggcaaagcgatcgccgccaaccttcgccagcagatagcc
caacgcgtgaccgagcgccgccagcaaggcctgcgcgttcccggcctggcggtgatcctg
gtcggcaccgatccggcctctcaggtctatgtggcgcacaagcgcaaggactgcgaggaa
gtcggctttctctcccaggcctacgatcttcccgccgaaaccagccaggacgacctgctg
gccctgatcgaccgcctgaacgacgaccccgccatcgacggcatcctggtccagctaccc
ctgcccgcccacctggacgcctccctgctgctggagcgcatccacccggacaaggacgtg
gacggtttccatccctacaacatcggccgcctggcccagcgcatgcccctcctgcgcccc
tgcaccccgaaaggcatcatgaccctgctcgccagcaccggcgccgacctgtacggcatg
gatgcggtcgtggtcggcgcctcgaacatcgtcggccggcccatggctctggagttgctg
ctgggtggctgcaccgtcaccgtgacccaccgcttcacccgcgacctggccgaccatgtg
tcgcgcgccgacctggtggtggtcgctgccggcaagccgggactggtcaagggcgagtgg
atcaaggaaggcgccatcgtcatcgacgtcggcatcaaccgccaggccgacggccgactg
gtcggcgacgtggaatacgaagtggcagcgcaacgcgccagctggatcaccccggtgccg
ggcggcgtcgggccgatgacccgcgcctgcctgctggaaaataccctgcacgccgccgaa
cacctgcacgactga

DBGET integrated database retrieval system