KEGG   Pseudomonas aeruginosa LESB58: PLES_44141Help
Entry
PLES_44141        CDS       T00818                                 

Definition
(GenBank) possible threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
pag  Pseudomonas aeruginosa LESB58
Pathway
pag00260  Glycine, serine and threonine metabolism
pag01100  Metabolic pathways
pag01110  Biosynthesis of secondary metabolites
pag01120  Microbial metabolism in diverse environments
pag01130  Biosynthesis of antibiotics
pag01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pag00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PLES_44141
Enzymes [BR:pag01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     PLES_44141
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: CAW29169
Position
complement(4851693..4852697)
Genome map
AA seq 334 aa AA seqDB search
MPVIDLRSDTVTQPTAGMREAMAAAELGDDVYGEDPTVNRLEAELAARLGFAAALFVPTG
TMSNLLGLMAHCERGDEYIVGQQAHTYKYEGGGAAVLGSIQPQPIDGEADGSLHLDKVAA
AIKADDFHFARTRLLALENTMQGKVLPLDYLAAARAFTRARGLALHLDGARLYNAAVKLG
VDASEITRHFDSVSVCLSKGLGAPVGSVLCGSVELIGKARRWRKMVGGGMRQAGLLAAAG
LYALDHQVARLADDHANAARLGDGLRELGYAVEPVQTNMVYVDVGERAVALRDFLAERGV
RISAAARLRLVTHLDVSAESIGQVLDAFAAFRRS
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgtcatcgacctgcgcagcgacaccgtcacccagcccaccgccggcatgcgcgaa
gccatggccgcggccgaactgggcgacgacgtctatggcgaggaccccacggtcaaccgc
ctggaggccgaactggcggcgcgcctgggcttcgccgcggcgctcttcgtaccgaccggg
accatgagcaacctgctcggattgatggcccactgcgagcgcggcgacgaatacatcgtc
ggccagcaggcgcatacctacaaatacgagggcggcggtgccgcggtgctgggctcgatc
cagccgcagccgatcgacggcgaggccgacggatcgctccacctggacaaggtcgcggcg
gcgatcaaggccgacgatttccacttcgccaggacccgcctgctggccctggaaaacacc
atgcagggcaaggtgctgccgctcgactacctggccgcggcgcgcgccttcactcgcgcg
cgtggcctggccctgcacctggatggcgcgcgcctgtacaacgcggcggtgaagctgggc
gtagacgccagcgagatcacccgacacttcgactcggtgtcggtgtgcctgtccaagggc
ctcggtgcgccggtgggctcggtgctttgcggcagcgtagaactgatcggcaaggcccgt
cgctggcgcaagatggtcggcggcgggatgcgccaggccggcctgttggcggctgccggc
ctgtacgccctcgaccaccaggtggcacgcctggccgacgaccacgccaacgccgcgcgc
ctgggcgacgggctgcgcgaactgggctatgcggtggagccggtgcagaccaacatggtc
tatgtcgatgtcggcgagcgggcggtcgcgctgcgcgacttcctcgccgagcgcggggtg
cggatcagcgcggcggcgcgtttgcgcctggtcacccacctggacgtttccgccgagtcc
ataggacaagtactggatgccttcgcggcctttcgtcgctcataa

DBGET integrated database retrieval system