KEGG   Pseudomonas aeruginosa LESB58: PLES_52851Help
Entry
PLES_52851        CDS       T00818                                 

Definition
(GenBank) probable aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
pag  Pseudomonas aeruginosa LESB58
Pathway
pag00010  Glycolysis / Gluconeogenesis
pag00053  Ascorbate and aldarate metabolism
pag00071  Fatty acid degradation
pag00280  Valine, leucine and isoleucine degradation
pag00310  Lysine degradation
pag00330  Arginine and proline metabolism
pag00340  Histidine metabolism
pag00380  Tryptophan metabolism
pag00410  beta-Alanine metabolism
pag00561  Glycerolipid metabolism
pag00620  Pyruvate metabolism
pag00625  Chloroalkane and chloroalkene degradation
pag00903  Limonene and pinene degradation
pag01100  Metabolic pathways
pag01110  Biosynthesis of secondary metabolites
pag01120  Microbial metabolism in diverse environments
pag01130  Biosynthesis of antibiotics
Module
pag_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:pag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PLES_52851
   00053 Ascorbate and aldarate metabolism
    PLES_52851
   00620 Pyruvate metabolism
    PLES_52851
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PLES_52851
   00561 Glycerolipid metabolism
    PLES_52851
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PLES_52851
   00310 Lysine degradation
    PLES_52851
   00330 Arginine and proline metabolism
    PLES_52851
   00340 Histidine metabolism
    PLES_52851
   00380 Tryptophan metabolism
    PLES_52851
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PLES_52851
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PLES_52851
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PLES_52851
Enzymes [BR:pag01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     PLES_52851
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: CAW30039
Position
complement(5828148..5829617)
Genome map
AA seq 489 aa AA seqDB search
MSDSRYTDLGLQPLAGEWRHGRAGRRLKVSNPFDGSLLLEIEQADRDDLDAAYAKAAEVQ
PAWAALGPSARAAVLYKAVEVFDRRHEEIVDWIIRESGSTRLKAEIEWGAARAITLESAS
FPARVHGRIVESDVPGKESRVYRSAIGVVGVISPWNFPLHLTQRSIAPALALGNAVVVKP
ASDTPVCGGLLLARIFEEAGLPAGLFSVVVGPGSEIGDAFVEHPVPGLVTFTGSTPVGRN
IGRIASGGAHLKHVALELGGNSPFVVLGDADLEQAVNAAVFGKFLHQGQICMAINRIIVE
DSLYDAFAARFVERVKGLRVGDPQRADTAVGPIVNARQLEGLLEKIRLARQEGAKPLYEG
GVDGQLLAPHVFGEVTATMEIARDEIFGPLVGLLRARDEAHALELANASEYGLSSAVFSR
DLERAVRFARQLRAGMTHVNDIPVNDEANAPFGGEKNSGLGRFNGDWAIEEFTTDHWISV
QHAPRQYPF
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgagcgattcccgttataccgacctcggtctccagcccctggccggcgagtggcgccac
ggccgggccggccgccggctgaaggtgagcaacccgttcgacggcagcctgttgctggag
atcgagcaggccgaccgcgacgacctcgatgccgcctacgccaaggccgccgaggtccag
ccggcatgggccgcgctcgggccctcggcacgcgcggcggtactgtacaaggcggtggag
gtgttcgaccgccgccacgaggagatcgtcgactggatcatccgcgagtccggcagcacc
cgcctgaaggccgagatcgaatggggcgcggcgcgcgcgatcaccctggagtcggcgtcg
ttcccggcacgggtgcacgggcgcatcgtcgagtccgacgtgccgggcaaggaaagccgg
gtctaccgcagcgccatcggcgtggtcggggtgatcagcccgtggaacttcccgctgcac
ctgacccagcgttccatcgccccggccctggcgctgggcaacgcggtggtggtcaagccg
gccagcgacacgccggtctgcggcggactgctgctggcgcggatcttcgaagaggccggg
ctgccggccgggctgttcagcgtggtggtcggccccggcagcgagatcggcgacgccttc
gtcgagcacccggtgccgggcctggtgaccttcaccggatcgaccccggtgggccgcaac
atcggccgcatcgccagcggcggcgcgcacctcaagcacgtggcgctggagctgggcggc
aacagtccgttcgtggtgctcggcgacgccgatctggagcaggcggtgaatgccgcggtg
ttcggcaagttcctccaccaggggcagatctgcatggcgatcaaccgcatcatcgtcgag
gatagcctctacgacgctttcgccgcgcgcttcgtcgagcgggtcaagggtctccgggtc
ggcgatccgcagcgcgccgataccgcggtcgggccgatcgtcaacgcgcgccagctcgaa
ggcctgctggaaaagatccgcctggcccgccaggaaggcgccaagccgctgtacgagggc
ggcgtcgatgggcagttgctggctccgcacgtattcggcgaggtcaccgcgacgatggag
atcgcccgcgatgaaatcttcggcccgctggtcggcctgctccgcgcgcgcgacgaggcg
catgcgctggagttggccaacgccagcgaatacgggctgtccagcgcggtgttcagccgc
gacctggaacgcgcggtgcgctttgcccgccagcttcgcgcggggatgacccacgtcaac
gacattccggtgaacgacgaggccaacgcgcccttcggcggcgagaagaactccggactt
ggccgcttcaacggcgactgggccatcgaggaattcaccaccgaccactggatcagcgtg
cagcacgcgccgcgccagtacccgttctga

DBGET integrated database retrieval system