KEGG   Pseudomonas aeruginosa LESB58: PLES_55861Help
Entry
PLES_55861        CDS       T00818                                 

Gene name
pckA
Definition
(GenBank) phosphoenolpyruvate carboxykinase
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
pag  Pseudomonas aeruginosa LESB58
Pathway
pag00010  Glycolysis / Gluconeogenesis
pag00020  Citrate cycle (TCA cycle)
pag00620  Pyruvate metabolism
pag01100  Metabolic pathways
pag01110  Biosynthesis of secondary metabolites
pag01120  Microbial metabolism in diverse environments
pag01130  Biosynthesis of antibiotics
pag01200  Carbon metabolism
Module
pag_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PLES_55861 (pckA)
   00020 Citrate cycle (TCA cycle)
    PLES_55861 (pckA)
   00620 Pyruvate metabolism
    PLES_55861 (pckA)
Enzymes [BR:pag01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     PLES_55861 (pckA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_16 AAA_25 AAA_33 AAA_29
Motif
Other DBs
NCBI-ProteinID: CAW30340
UniProt: B7V3T9
Position
complement(6180393..6181934)
Genome map
AA seq 513 aa AA seqDB search
MTQANNAVYTDISAAQLVEEAIRRGEGELAANGSLVVRTGHRTGRSPVDRFIVEEPSTKD
AIAWGNINRPFPADKFDALWARVEAFNNAQDHFISHVHVGSAEAYYLPVKMTTATAWQNL
FGRCLFIEPEQYNPAGKDEWQVLNVANFECVPERDGTNSDGCVILNFAQKKVLIAGMRYA
GEMKKAMFSVQNFLLPERDVLPMHCAANIGEAGDVTLFFGLSGTGKTTLSADESRYLIGD
DEHGWGEGVVFNVEGGCYAKCIDLSEKNEPVIWKAIKFGAVLENVVLDEERVPNYADDSL
TQNSRAAYPLEHVEKRSEKNLGGEPNAVIFLTCDLTGVLPPVSILNNEQAAYHFLSGYTA
LVGSTEMGSGGGIKSTFSTCFGAPFFPRPAGVYAELLIKRIKAFGSKVYLVNTGWTGGGY
GVGKRFNIPTTRGVIAAIQSGALIGAETEHLDIINLDVPKAVPGVETNLLNPRNTWADKA
AYDEAAKGLAKQFIENFKKFEVSDAIKAAGPQL
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaagccaacaacgccgtgtacaccgatatcagcgccgcccaactggtagaagaa
gccattcgccgcggtgagggcgaactggccgccaacggctcgctggtcgtacgtaccggc
catcgcaccggccgttcgccggtcgaccgtttcatcgtcgaagagccgagcaccaaggac
gcgatcgcctggggcaacatcaaccgtccgttcccggccgataagttcgatgcgctgtgg
gcccgcgtggaagcgttcaacaacgcccaggaccatttcatttcccatgttcatgtaggt
tccgccgaggcttactacctgccggtgaagatgaccaccgctaccgcctggcagaatctg
ttcggccgttgcctgttcatcgagccggagcagtacaacccggccggcaaggacgagtgg
caggtcctcaatgtcgccaacttcgaatgcgtgcccgagcgcgacggcaccaactccgac
ggttgcgtgatcctcaatttcgcccagaagaaagtgctgatcgcaggcatgcgctatgcc
ggcgagatgaagaaagccatgttctccgtgcagaacttcctgctgcccgagcgcgacgtg
ctgccgatgcactgcgctgccaacatcggcgaagcgggcgatgtgaccctgttcttcggc
ctgtccggcaccggcaagaccaccctgtccgccgatgaaagccgttacctgatcggtgac
gacgagcacggctggggcgagggcgtggtgttcaacgtcgaaggcggttgctatgccaag
tgcatcgacctgtccgagaagaacgagccggtcatctggaaagccatcaagttcggcgcc
gtgctggagaacgtggttctcgacgaagagcgcgtgcccaactacgccgatgacagcctg
acccagaacagccgcgccgcctacccgctggagcacgtcgagaagcgttcggagaagaac
ctcggcggcgagcccaacgcggtgatcttcctgacctgcgacctgaccggcgtactgccg
ccggtatcgatcctgaacaatgagcaggcggcctaccacttcctgtccggctacaccgcg
ctggtcggctccaccgagatgggttccggcggcggtatcaagtcgaccttctccacctgc
ttcggtgctcctttcttcccgcgtccggccggcgtctatgccgagctgctgatcaagcgc
atcaaggccttcggctccaaggtctacctggtcaacactggctggaccggtggtggctac
ggcgtcggcaagcgcttcaacatcccgaccacccgtggcgtgatcgcggcgatccagagc
ggcgcgctgatcggcgcggaaaccgagcacctggacatcatcaacctggacgtgccgaag
gccgttccgggcgtcgagaccaatctgctcaacccgcgcaacacctgggctgacaaggct
gcctacgacgaggcggcgaagggcctggccaagcagttcatcgaaaacttcaagaaattc
gaggtttccgatgcgatcaaggccgccggcccgcagctgtaa

DBGET integrated database retrieval system