KEGG   Pseudomonas aeruginosa LESB58: PLES_56611Help
Entry
PLES_56611        CDS       T00818                                 

Gene name
hcpB
Definition
(GenBank) secreted protein Hcp
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
pag  Pseudomonas aeruginosa LESB58
Pathway
pag02025  Biofilm formation - Pseudomonas aeruginosa
pag03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pag00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PLES_56611 (hcpB)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    PLES_56611 (hcpB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pag02044]
    PLES_56611 (hcpB)
Secretion system [BR:pag02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PLES_56611 (hcpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_HCP
Motif
Other DBs
NCBI-ProteinID: CAW30415
Structure
PDB: 

Position
complement(6268805..6269323)
Genome map
AA seq 172 aa AA seqDB search
MATPAYMSITGTKQGLITAGAFTEDSVGNTYQEGHEDQVMVQGFNHEVIIPRDPQSGQPT
GQRVHKPVVITKVFDKASPLLLAALTSGERLTKVEIQWYRTSAAGTQEHYYTTVLEDAII
VDIKDYMHNCQDPGNAHFTHLEDVHFTYRKITWTHEVSGTSGSDDWRSPVAG
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atggcaacccccgcctatatgtccatcaccggcaccaagcagggcctgatcaccgccggc
gccttcaccgaggattcggtcggcaacacctaccaggaaggccacgaggaccaggtgatg
gtccagggcttcaaccacgaagtgatcatcccgcgcgacccgcagtccggccagccgacc
ggccagcgcgtgcacaagccggtggtcatcaccaaggtcttcgacaaggcctcgccgctg
ctgctggccgccctgacctccggcgagcgcctgaccaaggtcgagatccagtggtaccgc
acctccgccgccggcacccaggagcactactacaccaccgtcctggaagacgcgatcatc
gtcgacatcaaggactacatgcacaactgccaggacccgggcaacgcccacttcacccac
ctggaagacgtgcacttcacctaccgcaagatcacctggacccacgaagtctccggcacc
tccggctccgacgactggcgctccccggtcgccggctga

DBGET integrated database retrieval system