KEGG   Pseudomonas aeruginosa LESB58: PLES_58161Help
Entry
PLES_58161        CDS       T00818                                 

Gene name
fdhA
Definition
(GenBank) glutathione-independent formaldehyde dehydrogenase
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
pag  Pseudomonas aeruginosa LESB58
Pathway
pag00625  Chloroalkane and chloroalkene degradation
pag00680  Methane metabolism
pag01100  Metabolic pathways
pag01120  Microbial metabolism in diverse environments
pag01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pag00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    PLES_58161 (fdhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PLES_58161 (fdhA)
Enzymes [BR:pag01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     PLES_58161 (fdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C AdoHcyase_NAD 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: CAW30570
Structure
PDB: 

Position
6437807..6439006
Genome map
AA seq 399 aa AA seqDB search
MSGNRGVVYLGPGKVEVQNIPYPKMQDPQGRQIDHGVILRVVSTNICGSDQHMVRGRTTA
PEGLVLGHEITGEVVEIGRGVETMKIGDLVSVPFNVACGHCRTCKEQHTGVCLTVNPARA
GGAYGYVDMGGWVGGQAEYVLVPYADFNLLKLPNREAAMEKIRDLTCLSDILPTGYHGAV
TAGVGPGSTVYIAGAGPVGLAAAASARLLGAAVVIVGDVNPTRLAHAKKQGFEIADLSKD
TPLHEQIAALLGEPEVDCAVDAVGFEARGHGHSGSQQEAPATVLNSLMGITRVAGKIGIP
GLYVTEDPGAVDAAAKHGALSIRFGLGWAKSHSFHTGQTPVMKYNRQLMQAIMWDRIKIA
DIVGVEVITLDDAPKGYGEFDAGVPKKFVIDPHNLFRAA
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgtctggcaatcgtggtgtggtctatctcggcccgggcaaggtcgaggtgcagaacatt
ccctatccgaagatgcaggacccgcagggccggcagatcgaccacggggtgatcctgcgg
gtggtctccaccaacatctgcggctccgaccagcacatggtgcgcggccgtaccaccgcg
ccggaaggcctggtgctgggccacgagatcaccggcgaggtggtggagatcgggcgtggc
gtggaaaccatgaagatcggcgacctggtctcggtaccgttcaacgtcgcctgcggccac
tgccgtacctgcaaggaacagcacaccggcgtctgcctgacggtcaatccggcgcgtgcc
ggcggcgcctacggctacgtcgacatgggtggctgggtcggcggccaggccgaatacgtg
ctggtgccctacgccgacttcaacctgctgaaactgcccaaccgcgaagcggcgatggag
aagatccgcgacctgacctgcctttcggacatcctccccaccggctaccacggcgcggtc
accgccggcgtcggcccgggcagcacggtctacatcgccggcgccggtccggtcggcctg
gccgcggcggcctcggcacgcctgctcggcgcggcggtggtgatcgtcggcgacgtcaac
ccgacccgcctggcccacgccaagaaacagggcttcgagatcgccgacctgtccaaggac
accccgctgcacgaacagatcgccgctctgctgggcgagccggaggtcgactgcgcggtc
gatgcggtcggtttcgaggcgcgcggccacggccattcgggctcgcagcaggaagccccg
gccaccgtgctcaactcgctgatgggcatcacccgggtcgccggcaagatcggcatcccc
ggcctgtacgtcaccgaagacccgggcgcggtggacgcggccgccaagcacggcgccctg
agcatccgcttcggcctgggctgggccaagtcgcacagcttccataccggccagaccccg
gtgatgaagtacaaccgccagctgatgcaggcgatcatgtgggaccggatcaagatcgcc
gacatcgtcggggtggaagtcatcaccctcgacgatgcgccgaaaggctatggcgagttc
gacgccggggtgccgaagaaattcgtcatcgacccacacaacctgttccgcgcggcctga

DBGET integrated database retrieval system