KEGG   Pseudoalteromonas agarivorans: PAGA_b0611Help
Entry
PAGA_b0611        CDS       T06137                                 

Gene name
ltaE
Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
paga  Pseudoalteromonas agarivorans
Pathway
paga00260  Glycine, serine and threonine metabolism
paga01100  Metabolic pathways
paga01110  Biosynthesis of secondary metabolites
paga01120  Microbial metabolism in diverse environments
paga01130  Biosynthesis of antibiotics
paga01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:paga00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PAGA_b0611 (ltaE)
Enzymes [BR:paga01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     PAGA_b0611 (ltaE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase DegT_DnrJ_EryC1 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: ATC84492
UniProt: A0A290RUU8
Position
II:complement(526015..527019)
Genome map
AA seq 334 aa AA seqDB search
MIDFRSDTVTKPSKAMRDVMYIAPVGDDVYGDDPSISQLEAYACERFSFEAALYCSSGTQ
ANLLALMAHCERGDEYICGQNAHNYKFEGGGAAVLGSIQPQPIENEPDGSLCFDKIAAAI
KPDDSHFANTRLLSLENTIGGKVLPLSYLAKARHFVNEHSLALHLDGARAFNAAVELNVD
ITDITQHFDSVSICLSKGLGAPVGSLLLGTKALITKARRWRKVLGGGMRQAGMLAAAGQY
ALENNVSRLKDDHANARYLASKLNELNGFSVDMSNTTNMVYARYSSELNIALISEQLAQQ
GILISPSKQLRLVTHLDINQDDIDTFIRALAAHI
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgatagattttcgctcagacacggttactaaaccttcaaaagccatgcgcgatgtaatg
tatatcgcgccagtaggcgatgatgtgtacggggatgatcctagcataagccaattagaa
gcctatgcatgtgagcgttttagctttgaagccgcactttattgtagctctggcacgcaa
gctaatttacttgcgcttatggctcattgcgaacgcggagatgaatatatttgcgggcaa
aatgcccataactataaatttgaaggcggtggcgctgcagtattaggctctattcaacca
caaccgattgagaatgaacccgatggcagcctctgctttgataaaattgccgcagcaata
aaaccagacgatagccattttgccaacacccgcttacttagccttgaaaacaccataggc
ggaaaagtgctcccccttagctacttagccaaagcacgtcattttgtaaatgagcactcg
ttggctctgcacttagatggcgcacgtgcgtttaatgcagcagttgaattaaacgttgat
attacagatataacccagcactttgactctgtttcaatttgcttatcaaaagggctaggt
gctcccgttggctcgctattactgggcacaaaggcgcttatcacaaaagcacggcgctgg
agaaaagtactcggtggtggcatgcgccaagccggaatgctggcagccgcggggcaatac
gcacttgaaaataacgtctctcgcttaaaagacgatcacgctaatgcgcgttatttagca
agtaagcttaacgaactcaatgggtttagcgttgatatgagtaacaccaccaacatggtg
tatgcgcgctattcaagtgagttaaatatagcgcttattagcgagcaattagcacaacaa
ggcatattaattagcccaagcaaacagcttaggctagtcactcatcttgatataaaccaa
gatgatatagatacttttatacgagccttagcggcccatatttaa

DBGET integrated database retrieval system