KEGG   Pantoea agglomerans C410P1: BEE12_01195Help
Entry
BEE12_01195       CDS       T04739                                 

Definition
(GenBank) amino acid ABC transporter permease
  KO
K10016  histidine transport system permease protein
Organism
pagc  Pantoea agglomerans C410P1
Pathway
pagc02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:pagc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BEE12_01195
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pagc02000]
    BEE12_01195
Transporters [BR:pagc02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    BEE12_01195
   Histidine transporter
    BEE12_01195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: AOE38621
UniProt: A0A2V1YXT7
Position
complement(307175..307864)
Genome map
AA seq 229 aa AA seqDB search
MLYGYSDVILRGTLVTLELALTSVVLAVLLGLIGAGAKLSRSRPLAMIFEGYTTLIRGVP
DLVLMLLIFYGLQIVLNQITDALGMAQFDIDPMVAGIITLGFIYGAYFTETFRGAFMAVP
QGQIEAATAFGFTGAQVFRRILFPAMMRYALPGIGNNWQVILKATALVSLLGLEDVVKAT
QLAGKSTWQPFYFAIVAGVIYLVFTTLSNGVLWWLNRRYTVGVKRASYD
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgctgtatggctattctgatgtaattcttcggggcacgctggtgacgctggagctggcg
ctcacttccgtcgtgcttgcagtgctgctgggcctgattggcgcaggcgcgaaactgtcg
cgcagccggccactggcgatgatttttgaaggctacaccacactgattcgtggcgtgcca
gacctcgtactgatgctgctgatcttctacggtctgcagattgtcctcaaccagataacc
gatgcactgggcatggcgcagtttgatatcgacccgatggtcgccggtatcatcacgctc
ggctttatctatggtgcctacttcaccgaaacgttccgcggcgcctttatggccgtgcct
caggggcagattgaagcagcaaccgcgtttggctttaccggcgcgcaggtgttccgccgc
attctgtttccggccatgatgcgctacgcgctgccaggcatcggcaacaactggcaggtg
attctgaaagccaccgcgctggtctcgctgctggggctggaagatgtggtgaaggcgacg
cagctggcaggaaaaagtacctggcagccgttctacttcgccattgtggccggtgtgatt
tatctggtgttcaccacgctatcaaacggtgtgctgtggtggctcaaccggcgctatacg
gtgggtgtgaagagggcgagttatgattga

DBGET integrated database retrieval system