KEGG   Pantoea agglomerans C410P1: BEE12_02925Help
Entry
BEE12_02925       CDS       T04739                                 

Definition
(GenBank) tRNA pseudouridine(65) synthase TruC
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
pagc  Pantoea agglomerans C410P1
Brite
KEGG Orthology (KO) [BR:pagc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pagc03016]
    BEE12_02925
Enzymes [BR:pagc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     BEE12_02925
Transfer RNA biogenesis [BR:pagc03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    BEE12_02925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: AOE38911
UniProt: A0A379ABK0
Position
complement(680991..681770)
Genome map
AA seq 259 aa AA seqDB search
MLEILYQDEWLVAVNKPSGWLVHRSWLDRHETVFVMQTVRDQIGQHVFTAHRLDKPTSGV
LLMGLSSEVGRLLSLQFEQHQMQKTYHAVVRGWLESSGTLDYPLVEELDKIADKHATEAR
TAQPAVTDYQSLATVEMPVGIGRYPTSRYSLVELAPKTGRKHQLRRHMSHLRHPIIGDSA
HGDLRQNRGAAEHFGANRLMLHASSLALTHPVTGEPLLLRAGLDGVWQNLMNQFGWQDRI
PEVPRVEFDAAPGQDNVSE
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgctggagatactctatcaggatgagtggctggttgccgtcaacaagcccagcggctgg
ctggttcatcgcagctggctggatcgtcatgaaacggtgtttgtgatgcagaccgttcgt
gatcagattggacagcatgtgtttacggcgcatcgtctcgacaagcccacgtcaggggta
ctgctgatggggctctccagtgaagtcggacgtctgctttccctgcagtttgaacagcac
cagatgcagaaaacctaccacgctgtggttcgcggctggctggagagcagcgggacgctc
gattatccgctggtggaagagctggataaaattgccgataaacacgccactgaagcgcgc
accgcacagcccgcggtcaccgattatcagtcactggcaacggtcgagatgccggtcggc
attggccgttatcccacttcgcgttatagcctggttgaactggctcctaaaaccggtcgc
aagcatcagctgcgtcgtcatatgtcacacctgcgtcatccgattattggcgattcggcg
cacggcgatctgcgtcagaaccggggtgccgccgaacattttggcgctaaccgtctgatg
ctgcacgccagcagcctggcattaactcacccagtgaccggtgaaccgttgctgcttcgc
gccggactggatggcgtctggcagaacctgatgaaccagtttggctggcaggatcgcatt
cctgaggtgccgcgggttgagtttgacgcagcgccaggacaggataacgtttcagaataa

DBGET integrated database retrieval system