KEGG   Pantoea agglomerans C410P1: BEE12_06235Help
Entry
BEE12_06235       CDS       T04739                                 

Definition
(GenBank) fructose-bisphosphatase, class II
  KO
K02446  fructose-1,6-bisphosphatase II [EC:3.1.3.11]
Organism
pagc  Pantoea agglomerans C410P1
Pathway
pagc00010  Glycolysis / Gluconeogenesis
pagc00030  Pentose phosphate pathway
pagc00051  Fructose and mannose metabolism
pagc00680  Methane metabolism
pagc01100  Metabolic pathways
pagc01110  Biosynthesis of secondary metabolites
pagc01120  Microbial metabolism in diverse environments
pagc01130  Biosynthesis of antibiotics
pagc01200  Carbon metabolism
Module
pagc_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pagc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BEE12_06235
   00030 Pentose phosphate pathway
    BEE12_06235
   00051 Fructose and mannose metabolism
    BEE12_06235
  09102 Energy metabolism
   00680 Methane metabolism
    BEE12_06235
Enzymes [BR:pagc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     BEE12_06235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_glpX
Motif
Other DBs
NCBI-ProteinID: AOE39490
Position
1383781..1384791
Genome map
AA seq 336 aa AA seqDB search
MKRELAIEFSRVTEAAALAGYHWLGRGDKNAADGAAVHAMRHVLNSIEIDGQIVIGEGEI
DEAPMLYIGEKVGTGRGDAVDIAVDPIEGTRMTALGQANALAVMAVGDKGSFLHAPDMYM
EKLIVGPTARGEIDLDLPLETNLRNIAIAMNKPLSQLTVSILAKPRHDAVISQLQQLGVR
VFTFPDGDVAASILTCMPDSEVDVMYGIGGAPEGVVSAAVIRALDGDMQGRLLARHHVKG
DSAENRLLGEQELQRCAEMGIEAGKKLTLNEMARNDNVVFAATGITSGELLKGITRQGNI
ATSETLLIRGKSRTIRRIQSIHYLDRKDPALHPFIL
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgagaacttgccattgaattttcccgcgtaaccgaagctgccgccctggcaggc
tatcactggttaggacgcggcgacaaaaatgcggctgacggcgcggctgtccatgccatg
cgtcatgtcctgaactccattgaaatcgacggtcagattgtgatcggtgaaggcgaaatc
gacgaagctccgatgctctatatcggtgaaaaagtcggtaccggccgcggcgatgcggtc
gacattgcggtcgatccgattgaaggcacccgcatgacggcgctgggccaggctaatgcg
ctggcggtgatggccgtgggcgataagggcagctttctgcacgcacccgacatgtacatg
gaaaaactgattgttggccccacagcgcgtggagagatcgatctcgacctgccgctggaa
accaacctgcgtaacatcgccatcgcgatgaataagccgctgtcgcagctaaccgtctcg
attctggcaaagccgcgtcatgacgcggtaatcagccagttgcagcagctgggcgtgcgg
gtgtttaccttcccggatggcgatgtcgccgcctccattctgacctgcatgccggacagc
gaagtcgatgtgatgtatggcatcggcggcgcaccggaaggcgtggtctctgcggcggtg
atccgcgcgctggatggggatatgcagggccggttgctggcgcgtcaccacgtgaaaggc
gacagcgctgaaaaccgtctgctgggtgagcaggagctgcagcgctgtgcagagatgggg
attgaagcgggcaaaaagctgacgctgaatgagatggctcgcaatgacaatgtggtgttt
gccgccaccggcattaccagtggcgaactcctgaaaggcattacgcgtcagggcaatatc
gccaccagcgagaccctgctgattcgcggtaaatcacgcaccatccgccgtattcagtcg
atccactatctcgaccgtaaagatccggcgctccatccctttatcctgtaa

DBGET integrated database retrieval system