KEGG   Pantoea agglomerans C410P1: BEE12_06365Help
Entry
BEE12_06365       CDS       T04739                                 

Definition
(GenBank) ADP-glyceromanno-heptose 6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
pagc  Pantoea agglomerans C410P1
Pathway
pagc00540  Lipopolysaccharide biosynthesis
pagc01100  Metabolic pathways
Module
pagc_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:pagc00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    BEE12_06365
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:pagc01005]
    BEE12_06365
Enzymes [BR:pagc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     BEE12_06365
Lipopolysaccharide biosynthesis proteins [BR:pagc01005]
 Unusual sugar
  BEE12_06365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd RmlD_sub_bind 3Beta_HSD NAD_binding_4 Polysacc_synt_2 KR NAD_binding_10 NmrA
Motif
Other DBs
NCBI-ProteinID: AOE39515
UniProt: A0A2V1YQ89
Position
1408518..1409450
Genome map
AA seq 310 aa AA seqDB search
MIIVTGGAGMIGSNIVKALNDRGHTDILVVDNLKDGTKFANLVDLDIVDYMDKEEFLMSV
MAGDDLGPIEAVFHQGACSSTTEWDGKYMMENNYQYSKELLHFCLEREIPFLYASSAATY
GGRNENFIEERQYEQPLNVYGYSKMLFDHYVRQMLPEANSPVCGFRYFNVYGPREGHKGS
MASVAFHLNTQISNDENPKLFEGSDGFKRDFIHVDDVAEVNLWCWENGVSGIYNCGTGRA
ESFQEVADAVLKFHQKGQIEYIPFPEKLKGRYQAYTQADLTKLRAAGYDKPFKTVAQGVA
DYMVWLNRNA
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgattatcgtaactggcggcgcaggaatgattggcagcaacattgtcaaagcgctgaac
gatcgcggtcacaccgacattctggtggtggataatctgaaggatggcaccaagtttgcc
aatttagtcgacctggatatcgtcgattacatggacaaagaagagttcctgatgagcgtg
atggcgggcgatgatttaggcccgatcgaagcggtgttccatcagggcgcctgctcctcc
accaccgagtgggatggcaagtacatgatggaaaacaactatcagtactccaaagagctg
ctgcacttctgtcttgagcgcgagatcccgttcctctacgcttcttccgcagcgacctac
ggcggacgcaatgagaatttcattgaagagcgtcagtatgagcagccgcttaatgtttat
ggctactccaagatgctgttcgaccattacgtccgtcagatgctgccggaagcgaactcg
ccggtatgcggcttccgctatttcaacgtctatggaccgcgtgaaggccacaagggcagc
atggcaagcgttgccttccatctgaacacgcagatcagcaacgatgaaaatccaaaactg
tttgaaggcagcgacggctttaaacgtgatttcatccacgttgatgatgttgcggaagtg
aacctgtggtgctgggaaaatggcgtctccgggatttacaactgtggcacaggccgcgcc
gagtccttccaggaagtggctgacgcagtactgaagttccaccagaaaggtcagatcgag
tacatcccgttcccggaaaagctcaaaggacggtaccaggcctatactcaggccgatctc
actaaattgcgtgccgctggctacgacaagccatttaaaacggtggcgcagggcgtcgct
gactatatggtctggctgaaccgtaacgcataa

DBGET integrated database retrieval system