KEGG   Pantoea vagans FDAARGOS_160: AL522_00720Help
Entry
AL522_00720       CDS       T04302                                 

Definition
(GenBank) D-threonate 4-phosphate dehydrogenase
  KO
K22024  4-phospho-D-threonate 3-dehydrogenase / 4-phospho-D-erythronate 3-dehydrogenase [EC:1.1.1.408 1.1.1.409]
Organism
pagg  Pantoea vagans FDAARGOS_160
Brite
KEGG Orthology (KO) [BR:pagg00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AL522_00720
Enzymes [BR:pagg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.408  4-phospho-D-threonate 3-dehydrogenase
     AL522_00720
    1.1.1.409  4-phospho-D-erythronate 3-dehydrogenase
     AL522_00720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PdxA
Motif
Other DBs
NCBI-ProteinID: AMG56259
Position
unnamed2:complement(45224..46204)
Genome map
AA seq 326 aa AA seqDB search
MSKIIAITMGDPAGISPEIIIKALSEGELNGIPAVVIGCAGTLRRIMAMNITPQAELRVL
DRVADAHFAPGIINVIDEPLADRDALKPGVVQKEAGDLAWRCVKRATELALAGEVHALAT
APLNKEAMHAAGHLYPGHTELLAHLTDTRDYAMVLYTDKLKVIHVTTHIALRKFLDTLNQ
TRIRTVIGMADTFLRRVGYSAPRIAVAGVNPHAGENGLFGDEEMTTVAPAIDAMKAQGID
VAGPCPPDTVFLQCQDGRYDMVVAMYHDQGHIPLKLLGFYDGVNITAGLPFIRTSADHGT
AFDIAWTGKAKSDSMAISIKLAMQLA
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
gtgagtaaaattattgcgatcaccatgggcgatccggcgggcatcagcccggaaatcatc
atcaaagcgctctctgaaggtgagctgaatggcatccctgccgtggtgattggctgtgcc
ggtacgctgcgccgcattatggcgatgaacatcacgccacaggccgagctgcgggtgctg
gaccgggtcgccgatgcgcactttgcgcccggcattatcaacgtgatcgatgagccgctg
gccgaccgcgatgcgctgaaacctggcgtggtgcagaaagaggccggggatctggcgtgg
cgctgcgtgaagcgtgccaccgaactggcgctggccggtgaggtgcatgccctggccacc
gcgccgctgaacaaagaggcgatgcacgcggcgggccatctctatccgggtcacaccgaa
ctgctggcgcaccttaccgacaccagagattacgccatggtgctctacaccgataagctc
aaggtgattcatgtcacaacccatattgcgctgcgtaagttcctcgacacgctcaaccag
acgcgcatcagaacggtgattggtatggcggacaccttcctgcgtcgtgtcggctacagc
gccccgcgtatcgccgtcgcgggtgtcaatccgcacgccggtgagaacgggctgtttggc
gatgaggagatgaccaccgttgcccccgcgatagacgcgatgaaagcgcaggggattgat
gtcgccgggccttgcccgccggacacggtgttcctgcagtgccaggatggacgctatgac
atggtggtggcgatgtaccacgatcaggggcacatcccgcttaaactgctgggcttctat
gatggcgtcaacattaccgcaggcctgccgtttatccgcacctctgctgaccacggcacg
gcatttgatatcgcctggacaggtaaagcgaagtctgacagcatggcgatctcgattaaa
ctcgcgatgcagctcgcatag

DBGET integrated database retrieval system