KEGG   Pantoea vagans FDAARGOS_160: AL522_00945Help
Entry
AL522_00945       CDS       T04302                                 

Definition
(GenBank) DJ-1/PfpI family protein
  KO
K18199  cyclohexyl-isocyanide hydratase [EC:4.2.1.103]
Organism
pagg  Pantoea vagans FDAARGOS_160
Pathway
pagg00930  Caprolactam degradation
Brite
KEGG Orthology (KO) [BR:pagg00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    AL522_00945
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:pagg01002]
    AL522_00945
Enzymes [BR:pagg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.103  cyclohexyl-isocyanide hydratase
     AL522_00945
Peptidases [BR:pagg01002]
 Cysteine Peptidases
  Family C56: PfpI endopeptidase family
   AL522_00945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DJ-1_PfpI
Motif
Other DBs
NCBI-ProteinID: AMG56300
Position
unnamed2:complement(95254..95982)
Genome map
AA seq 242 aa AA seqDB search
MNRPLQIGLLLFPDVTQLDLTGPWEVFARTPGVECHLIWKDRQPVRSDRGLSILPTATFD
DCPLLHVICVPGGPGQIALMSDEETLNFLRRQAEQAQWVTSVCTGSLVLGAAGLLAGYRA
TSHWSSIDQLALLGAEPVNQRVVRDRNRISGAGVTSGIDFALTLVAEIAGDAVARAVQLQ
MEYDPEPPFTCGSPQTALPREVEQARAKMAEFIATRRAATERAARRLQTDQLTDAGDTQQ
QQ
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgtccgctacagattggtctgttactgtttcctgatgttacccagctcgattta
actggcccgtgggaggtatttgcacgcacgcccggcgtggagtgccatctgatctggaaa
gatcgtcagccggtacgttccgatcgcggcctgtcgatattaccgactgctacctttgac
gattgcccattactgcatgtgatctgcgtaccgggtgggccaggacagattgccctgatg
tcggatgaggaaacgctgaattttctgcgtcggcaggctgagcaggcgcagtgggtcact
tcggtctgtaccggttcgctggtgctgggcgctgccggattgctggcgggataccgtgcg
acctcacactggagttccatcgatcaactggctttgctgggtgcggagccggtgaatcag
cgggtggtgcgtgaccgcaatcgtatcagcggcgcgggcgtcacttccggcatcgatttc
gccctgacgctggtggcagaaatcgccggggacgccgtcgccagagccgttcagctgcag
atggaatatgatcccgaaccgccatttacctgcggctcgccgcagaccgcgctgcccagg
gaggtggagcaggcgcgggcgaaaatggctgagttcatcgccacgcgtcgtgcagcaacg
gagcgcgccgcgcggcgattacagactgatcagcttacggacgccggggatacgcaacag
cagcagtga

DBGET integrated database retrieval system