KEGG   Pantoea vagans FDAARGOS_160: AL522_02255Help
Entry
AL522_02255       CDS       T04302                                 

Definition
(GenBank) two-component system sensor histidine kinase DcuS
  KO
K07701  two-component system, CitB family, sensor histidine kinase DcuS [EC:2.7.13.3]
Organism
pagg  Pantoea vagans FDAARGOS_160
Pathway
pagg02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pagg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AL522_02255
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pagg01001]
    AL522_02255
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:pagg02022]
    AL522_02255
Enzymes [BR:pagg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     AL522_02255
Protein kinases [BR:pagg01001]
 Histidine kinases
  CitB family [OT]
   AL522_02255
Two-component system [BR:pagg02022]
 CitB family
  DcuS-DcuR (C4-dicarboxylate metabolism)
   AL522_02255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: sCache_3_2 HATPase_c HATPase_c_5 SPOB_a PAS HATPase_c_2 PAS_4 PAS_8 dCache_3 HATPase_c_3 AIRS
Motif
Other DBs
NCBI-ProteinID: AMG56526
Position
unnamed2:381478..383112
Genome map
AA seq 544 aa AA seqDB search
MTSQPQKRHAVTKRPMKLSTLTTLMMTAVIVTVLLAVHLLYFVQIDNFAQSHLKDKAMAV
ARTLADSPEVQRGLLLSDGSSQIQPLAEAARKRNGLLFVVVTDMRGIRFSHPNAAVIGKH
FVGNDIYPTLSGRENVAVNHGVLVEALRVFTPVYNAQHQQIGVVAIGIALNDVAAQIAKS
RWNIVWTVLFGGVVGLLGILILVRRLKKILLGLEPHEISSLFEQRQAILNSIKEGVIAVD
DQSRVSLINYAAQQLLHETTRRMPLSGDLIAEESVMHRHQQDALHAGKAWHDQELTLGNR
ILISNTVPVRSRDRIIGAVTTFRDKTEISQLMQRLDGMVNYVDALRERSHEFMNKLHVIL
GLLHMKNYAQMEEYILKTANAYQTEIGSLLQKIKSPIIAGFLLSKINRVTDEGHQLIIDE
ASFLPDCGSEEQSAVLITVLGNLIENALEALDPETEGEIHLMLHYQNGWLACEVSDDGPG
IDSSQLSAIFERGVSSKGDDRGVGLFLVKQQTESLGGNVSVESEPGVFTQFLVQLPWERG
MITQ
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgacaagccaaccacagaaacgacatgccgtgacgaaacgacccatgaaactcagtacc
ctgaccaccctcatgatgactgcggtgatcgttaccgtgctgctcgctgtccatctgctc
tatttcgttcagattgataactttgcccagtcgcatcttaaagataaagcgatggcggtg
gcgcgaacgctggcagacagcccggaagtgcagcgtgggttactcttatcagacggcagc
agccagattcagccgctggcggaagccgcgcgcaaacgcaacggcctgctgtttgtggtg
gtgacggacatgcgcggcattcgcttttcacatcccaatgccgcggtgatcggcaaacat
tttgtcggcaatgacatctatcccacgctgagtggccgggaaaatgtggcggtcaatcat
ggcgtgctggtggaggcactgcgggtgtttacgccggtctataacgcacagcatcagcag
attggcgtggtggcaatcggcattgcgctcaatgatgtggcagcccagattgcgaagagc
cgctggaatatcgtctggaccgtcctgtttggcggtgtggtcgggctgctgggtattctg
attctggtcaggcgactcaagaaaatattgctggggctggagccgcacgaaatctccagc
ctgtttgaacagcgccaggcgatcctgaattctattaaagaaggggtgattgcggtcgat
gatcagtcacgtgtcagcctgatcaactacgcggctcagcagctgctgcatgagaccacc
cgcaggatgccgttaagcggtgacctgattgctgaggagagcgtcatgcatcgccatcag
caggatgcgctgcatgcgggcaaagcctggcatgatcaggagctgacgctgggtaatcgc
atcctgatcagcaacaccgttccggtgcgcagtcgtgaccgcattatcggcgcggtaacg
acgttcagggataagaccgaaatcagccagctgatgcagcgtctggacggcatggtaaac
tacgtagatgcgttacgtgagcggtcccatgagttcatgaataagctgcatgtgattctg
ggcctgctgcatatgaaaaattatgcacagatggaagagtacatcctgaaaaccgctaac
gcctatcagactgagatcggttcgctgctgcaaaagatcaaatcgccaatcatagccggt
ttcctgctcagcaaaatcaaccgggtaaccgatgaaggtcatcagctgattatcgatgag
gcgagttttctgcccgactgcggcagcgaggagcagagcgcggttctgattactgtgctg
ggcaatttaattgaaaatgcccttgaggcgctggacccggaaaccgaaggggaaattcac
ctcatgctgcattatcagaatggctggttagcctgcgaagtgagtgatgacgggccgggt
atcgacagctcccagctcagcgccatttttgagcgcggcgtctcgtcaaaaggcgacgat
cgcggtgtcggactgtttctggttaagcagcaaaccgaaagcctgggtggtaatgtcagt
gttgagtcggaacccggtgtatttacccaatttttagtgcaacttccgtgggagagagga
atgattacccaatga

DBGET integrated database retrieval system