KEGG   Pantoea vagans FDAARGOS_160: AL522_03835Help
Entry
AL522_03835       CDS       T04302                                 

Gene name
metF
Definition
(GenBank) methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
pagg  Pantoea vagans FDAARGOS_160
Pathway
pagg00670  One carbon pool by folate
pagg01100  Metabolic pathways
pagg01120  Microbial metabolism in diverse environments
pagg01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pagg00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    AL522_03835 (metF)
Enzymes [BR:pagg01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     AL522_03835 (metF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-ProteinID: AMG56826
Position
complement(69221..70120)
Genome map
AA seq 299 aa AA seqDB search
MSFFHANQREALNQSLAELNGQINVSFEFFPPRTSEMEETLWSSIDRLSSLKPKFVSVTY
GANSGERDRTHSIIKGIKDRIGLEAAPHLTCVDATHDELRTIAQDYWNNGIRHIVALRGD
LPPGSGKPEMYGSDLVSLLKEVGDFDISVAAYPEVHPEAKSAQADLINLKRKIDAGANRA
ITQFFFDVESYLRFRDRCVSTGIDVEIVPGILPVSNFKQLQRFATLTNVRVPGWMSAMFA
GLDDDPETRKMVGANIAMDMVKILSREGVKDFHFYTLNRAEMSYAICHTLGVRPVAAAA
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgagtttctttcatgccaatcagcgcgaagcgctaaaccagagcctggctgaactgaac
gggcagattaatgtgtcgtttgagttctttccgccgcgcaccagcgaaatggaagagact
ctgtggtcctcaattgatcgcctgagcagtctgaaaccgaaattcgtttctgtcacttat
ggtgcgaactcaggtgaacgcgatcgcacccacagcattatcaaaggcattaaagatcgc
attggcctggaagcagcaccccatctgacctgtgttgatgcgacgcatgatgaactgcgt
accatcgctcaggattactggaacaacggcatccgccatattgtggcgctgcgtggcgat
ctgccacctggcagcggcaagccagagatgtacggcagcgatttggtttcgctgctgaaa
gaggtaggcgattttgatatctccgtcgccgcctatccggaagttcatcccgaagcgaaa
agcgcccaggccgacctgattaatctcaaacgaaaaattgatgcaggcgcaaaccgggcc
attacccagtttttcttcgacgtcgaaagctatctgcgtttccgcgaccgctgtgtctcg
accggcattgatgtggaaattgtgccgggcatcctgccggtctctaactttaagcagctg
caacgctttgccacgctgaccaatgtgcgcgtgcccggctggatgagcgcgatgtttgcc
ggtctggatgacgatccggaaacgcgcaaaatggtgggagcgaatatcgcgatggatatg
gtgaaaatcctgtcacgcgaaggggtgaaagatttccatttttacacgctaaaccgtgcc
gaaatgagttacgctatctgccacacgttaggggttcgtcccgttgcggcggcggcttga

DBGET integrated database retrieval system