KEGG   Pantoea vagans FDAARGOS_160: AL522_04825Help
Entry
AL522_04825       CDS       T04302                                 

Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
pagg  Pantoea vagans FDAARGOS_160
Pathway
pagg00051  Fructose and mannose metabolism
pagg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pagg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    AL522_04825
Enzymes [BR:pagg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     AL522_04825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh 3HCDH_N UDPG_MGDP_dh_N F420_oxidored
Motif
Other DBs
NCBI-ProteinID: AMG57012
Position
complement(280849..281997)
Genome map
AA seq 382 aa AA seqDB search
MKALHFGAGNIGRGFIGKLLADAGIELVFADVNQTVLDALNARHEYPVHVVGEQAKVETV
KGVSAVNSTSDEIITLVSEVDLVTTAVGPQILERIAGSVAKGLAKRSDNGNTRPLNIIAC
ENMVRGTSQLKQHVLKALPEKYHAWLEQHVGFVDSAVDRIVPPSEAGSTDPLEVTVETFS
EWIVDKTQFKGDLPTITGMELTDNLMAFVERKLFTLNTGHAITAYLGQLAGLQTIRDAIL
DEKVRAVVKGAMEESGAVLIKRYGFDAEKHAAYIRKILGRFENPYLKDDVERVGRQPLRK
LSAGDRLIKPTLGTLEYGLPHASLVQGIAAAMHYRSDQDPQAQELAALLAEKGPQATLAE
ISGLDADSEVVASVVSAWHAMA
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgttacatttcggagcaggaaacattggtcgcggctttatcggcaaattactg
gctgatgcaggtatcgaactggtttttgctgatgtgaatcagacggtgctggatgcactg
aacgcgcgtcatgagtatcccgttcatgtggttggcgagcaggccaaagtggaaaccgtt
aaaggcgtcagtgcggtcaacagcaccagcgatgagatcatcaccctggtgtctgaagtc
gatctggtcaccaccgccgtgggtccgcagattctggaacgtattgccggcagtgtggct
aaagggctggcaaaacgcagcgacaacggcaacacccgtccgttaaatatcatcgcctgt
gaaaacatggtgcgcggcaccagccagctgaaacagcatgtactgaaggcgctgccggag
aagtatcacgcctggctggagcagcatgtcggctttgtggattccgcagttgaccgtatc
gtgcccccttctgaagcgggcagcaccgatccgctggaagtgaccgttgagaccttcagc
gaatggatcgtcgataaaactcagtttaaaggcgacctgccgaccattacgggcatggag
ctgactgataatctgatggcctttgtggagcgtaaactctttaccctgaacaccggtcac
gccattaccgcctaccttggccagctggccggtcttcagaccattcgcgacgccatcctc
gacgaaaaagtccgggccgtggtgaaaggcgcgatggaagagagcggcgcggtgctgatt
aagcgttacggttttgacgcggagaaacatgcggcctacatccggaagattctgggtcga
tttgaaaatccgtatctgaaagatgatgtggaacgcgtgggccgtcagccgctgcgtaaa
ctcagcgcgggcgatcgcctgatcaagccgacgctgggcacgctggagtatggtttgccg
cacgccagcctggtgcagggcattgccgccgcgatgcactatcgcagcgatcaggaccca
caggcgcaggagctggccgcgctgctggccgaaaaaggcccacaggcgacgctggctgag
atttcagggctggatgccgacagcgaagtggtggcttctgtggtgagcgcctggcacgct
atggcataa

DBGET integrated database retrieval system