KEGG   Pantoea vagans FDAARGOS_160: AL522_10845Help
Entry
AL522_10845       CDS       T04302                                 

Definition
(GenBank) low-specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
pagg  Pantoea vagans FDAARGOS_160
Pathway
pagg00260  Glycine, serine and threonine metabolism
pagg01100  Metabolic pathways
pagg01110  Biosynthesis of secondary metabolites
pagg01120  Microbial metabolism in diverse environments
pagg01130  Biosynthesis of antibiotics
pagg01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pagg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AL522_10845
Enzymes [BR:pagg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     AL522_10845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Cys_Met_Meta_PP DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: AMG58090
Position
complement(1559222..1560223)
Genome map
AA seq 333 aa AA seqDB search
MIDLRSDTVTRPSAAMLSAMMSAETGDDVYRDDPTVNALEAEAARLSGKAAALFFPTGTQ
ANLVALLSHCERGDEYIVGQQAHNYKYEAGGAAVLGSIQPQPMLAADDGTLPLDVVAAAI
KPDDIHFARTRLLSLENTHHGKVLPLDYLEQAWTFTREHRLALHIDGARIFNAVVAQNTT
LAAIARYCDSLTICLSKGLGTPVGSLLCGDTALIERARRWRKMTGGGMRQVGILAAAGLY
ALEHNVARLQEDHDNAAWLGQQLHELGASVIDQQTNMLFVAVPEAQVKPLGEWMKARGVL
ISVGTRTRLVTHLDADRAALEQVVAHWKAFLQQ
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgatttacgcagtgataccgtgacccggcccagcgccgccatgttaagcgcgatg
atgtcagccgaaaccggtgatgacgtctaccgtgacgatcccaccgtgaatgcactggag
gcggaagctgcacggctgagcggcaaagccgcagcactgtttttcccgaccggcacccag
gcaaacctggtggcgttgctcagccactgcgagcgcggcgatgaatatatcgtcggtcag
caggcgcacaactacaaatatgaagcgggcggtgcggcggtgctgggcagcattcagccg
cagccgatgctggccgccgatgatggcaccctgccgctcgatgtggtggcagcggccatt
aagccggatgatattcactttgcccgcacccgcctgctgagtctggagaacacccatcac
ggcaaagtactgccgctggattatctggaacaggcctggacctttacccgcgagcacagg
ctggcgctgcacattgatggcgcacgcattttcaacgcggtggtggcgcagaacaccacg
ctggcggcgattgcccgctactgcgacagcctgaccatctgtctctctaaaggtttgggt
acgcccgtcggttcgctactgtgcggcgacacggcgctgattgagcgcgcccgtcgctgg
cgcaaaatgaccggcggcggcatgcgtcaggtgggtattctggcggcggcgggtctctat
gcgttagagcacaacgtggcgcgactgcaggaggatcatgacaatgccgcctggctggga
cagcagctgcatgagctgggcgccagcgtcatcgatcagcagaccaacatgctgtttgtg
gcggtgccggaagcccaggtcaaacccttaggcgagtggatgaaggcacgcggcgtgtta
atcagcgtgggaacacgcacccgactggttactcatctggatgctgaccgtgcggcgctg
gagcaggttgtcgcccactggaaggcgtttctccaacagtaa

DBGET integrated database retrieval system