KEGG   Pantoea vagans FDAARGOS_160: AL522_16890Help
Entry
AL522_16890       CDS       T04302                                 

Definition
(GenBank) two-component system sensor histidine kinase BaeA
  KO
K07642  two-component system, OmpR family, sensor histidine kinase BaeS [EC:2.7.13.3]
Organism
pagg  Pantoea vagans FDAARGOS_160
Pathway
pagg02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pagg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AL522_16890
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pagg01001]
    AL522_16890
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:pagg02022]
    AL522_16890
Enzymes [BR:pagg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     AL522_16890
Protein kinases [BR:pagg01001]
 Histidine kinases
  OmpR family
   AL522_16890
Two-component system [BR:pagg02022]
 OmpR family
  BaeS-BaeR (envelope stress response)
   AL522_16890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HAMP HisKA HATPase_c_5 HATPase_c_2 Haemocyan_bet_s CHDCT2
Motif
Other DBs
NCBI-ProteinID: AMG59167
Position
2854206..2855594
Genome map
AA seq 462 aa AA seqDB search
MSVNLRLGIGAKLFMAIFATCMLVLITMHWGVRLSFEHGFVDYIKRGNEQRLNLLSDALA
DQYEQHGNWDFLRHNDRLVFTMLRSLEQNPDSNSQLPPHGWRTQFWILDQQYKVMVGPRA
PVPPEGTRRNITTSTGKVVGWVIGSPPERLTRSTDINFDQQQRRTSWIIVGLSTLLAALA
TWLMARGLLAPVKRLVDGTHHLAAGNFATRVEVSSRDELGQLAGDFNLLASSLEKNESMR
RAFMADISHELRTPLAILRGELEAMQDGVRKLTPDAIASLQSEVVVLTKLVEDLHQLSLS
DVGALAYRKQGTDLVQLLEVTAGSFAERYRAHGLTLTLNMPDNAPFFGDPDRLMQLFTNL
LENSLRYTDSGGRVDVTLKYEAPHWHIEFDDSAPGVDREHQVQIFERFFRTEGSRNRASG
GSGLGLAICKNIADAHGGDIHAAHSDLGGLKIALHLRYVPPV
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgagcgttaacctgcgcctgggcatcggggccaaactgtttatggcgattttcgctacc
tgcatgctggtgctgatcaccatgcactggggcgttcgccttagtttcgaacacggcttt
gtcgactacatcaagcgcggcaatgagcagcggttaaatctgctcagcgatgcgctggcc
gatcagtatgagcaacacggtaactgggattttctgcgccacaacgatcggctggtcttc
accatgctgcgctcacttgagcagaatcccgacagcaacagccagctgccgccacacggc
tggcgcacccagttctggatcctcgatcagcaatataaagtgatggtcgggccgcgcgcg
ccggtgccgccggagggaacgcgccgcaacattaccaccagcaccggtaaagtggtcggc
tgggtcatcggctcgccaccggagcggctgacgcgcagtaccgatattaactttgatcaa
cagcagcggcgcaccagctggattatcgtggggctgtcaacgctgctggcggcgctggcg
acctggctgatggcgcgtggcctgctggcgccggttaagcggctggtcgatggcacgcat
catctggcggccggtaattttgccacccgcgttgaggtcagcagccgggatgagctgggc
cagctggccggtgactttaacctgctggccagctcgctggagaaaaacgaaagcatgcgc
cgtgcctttatggctgatatctcccatgagctgcgcacgccgctggcgatcctgcgcggt
gaactggaagcgatgcaggatggcgtacgcaaactaacgccggatgcgatcgcctcactg
cagagtgaagtcgtggtgctgaccaagctggtcgaagacctgcatcagctgtcgctgtcg
gatgtgggtgcccttgcctatcgcaagcaggggaccgatctggtgcaactgctggaagtg
accgccggcagctttgccgaacgttatcgcgcgcacggcctgacgctgacgctgaatatg
cccgacaatgcccctttcttcggcgatcccgaccgcctgatgcagctgttcaccaacctg
ctggagaacagtctgcgctacaccgacagcggtggacgggttgacgtgacgctgaagtat
gaagccccccactggcacattgagtttgatgacagcgcacccggcgttgacagagaacat
caggtgcagatttttgagcgctttttccgcaccgaaggctcacgcaatcgcgccagcggc
ggctcgggcctgggcctggccatctgtaaaaatatcgctgatgcgcacggcggcgatatt
catgcggcgcactctgatttaggtggactgaaaatcgcgctacacttgcgctatgttccc
cctgtgtaa

DBGET integrated database retrieval system