KEGG   Planktothrix agardhii: NIES204_28370Help
Entry
NIES204_28370     CDS       T05658                                 

Gene name
zwf
Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
pagh  Planktothrix agardhii
Pathway
pagh00030  Pentose phosphate pathway
pagh00480  Glutathione metabolism
pagh01100  Metabolic pathways
pagh01110  Biosynthesis of secondary metabolites
pagh01120  Microbial metabolism in diverse environments
pagh01130  Biosynthesis of antibiotics
pagh01200  Carbon metabolism
Module
pagh_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
pagh_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:pagh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    NIES204_28370 (zwf)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    NIES204_28370 (zwf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pagh04147]
    NIES204_28370 (zwf)
Enzymes [BR:pagh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     NIES204_28370 (zwf)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     NIES204_28370 (zwf)
Exosome [BR:pagh04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   NIES204_28370 (zwf)
  Exosomal proteins of colorectal cancer cells
   NIES204_28370 (zwf)
  Exosomal proteins of bladder cancer cells
   NIES204_28370 (zwf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: BBD55528
UniProt: A0A2Z6CG97
Position
complement(3200424..3201953)
Genome map
AA seq 509 aa AA seqDB search
MVTLIENPLRVGLQQDRIPEPQILVIFGASGDLTQRKLVPALYQMKLERKLPPEITIVGV
ARREWSHDFFREHLREGVEAFGGGLYSQALWDDFAQGIFYCSGNMDEPESYQKLKAFLGE
IDELRHTRGNRVFYLSVAPRFFAEAIQQLGGAGMLPDPKKQRLVIEKPFGRDLGSAQILN
RVVRQVCCEEQVYRIDHYLGKETVQNLMVFRFGNAIFEPLWNRQFVDHVQITVAETVGLE
GRAGYYETSGALRDMVQNHLMQLFSLTAMEPPNSLDADSIRNEKVKVVQATHLADTNFLE
YSAVRGQYTPGWMNGLQVPGYRSEDGAALESITPTYAALKFYIDNWRWKGVPFYLRTGKR
MPKKVTEIAIQFKEVPFLMFQSAAKQANPNVLVLRIQPNEGISMRFEVKTPGNSLRTRSV
DMDFRYDTAFGKANTDAYARLLVDCMLGDQTLFTRGDEVEASWQALTPVLEVWDAPAPAE
SIPLYEAGTWGPVESELLLNRDGRRWRRL
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atggtaacactgattgaaaatcccttgcgggtgggactgcaacaagatcgaattcccgaa
ccccagattttagtaatttttggtgcatcgggagacttaacccaacggaaattagtccca
gccctctaccagatgaaattagagcgcaaacttccgccagaaataaccattgtcggggtt
gctcgtcgggaatggagccacgactttttccgcgaacacctgcgggaaggggtggaagca
tttgggggcggtttatattcccaagccctttgggacgacttcgcccaagggattttttac
tgttcggggaatatggatgaacccgaaagttaccaaaaactcaaagcctttttaggggaa
atcgatgaactgcgccacaccagaggaaaccgagtcttttatttatccgtagccccacgt
ttttttgccgaagccattcaacaattaggtggagccggaatgctccccgaccccaaaaaa
cagcgtttagtcattgaaaaaccctttggtcgagatttaggttcggcccaaattctcaac
cgggtggtgcgtcaagtctgttgcgaagaacaggtctatcggattgaccattatttgggg
aaagaaaccgtccaaaacttgatggtgtttcgatttggcaatgcgatttttgagcccctg
tggaaccgtcaatttgtcgatcacgtccaaattaccgtggcggaaaccgttggtttagaa
ggacgggcgggctattatgaaacttccggggcgctgcgggatatggtacaaaaccatctg
atgcagttattttccctgacggcgatggaaccccccaactccctcgacgccgatagcatt
cgtaacgaaaaagttaaggtggtacaagcaacccacctggctgatactaattttttagaa
tattctgcggtacggggacaatatacccccggttggatgaatggcctacaggttccgggt
tatcgttccgaagatggagccgccctggagtccatcaccccaacctatgccgcgttaaaa
ttttatattgataactggcgctggaagggtgtcccgttctatctgcgaaccggaaaacga
atgccgaaaaaggtgacggaaattgccattcaatttaaagaagtgccatttttgatgttc
cagtccgcggcaaaacaggccaacccgaacgttttggtcttgagaattcaaccaaatgaa
ggaatttccatgcgctttgaggtgaaaacccccggaaattctctgcggactcgttccgtt
gatatggattttcgctatgatacggcttttggtaaagcgaatacagatgcctatgcccgt
ttattggttgactgtatgttaggagatcaaaccctatttacacggggggatgaagtcgaa
gcctcttggcaagccctcaccccggttttagaagtttgggatgccccagccccagccgag
tctatcccgctctatgaagccggaacttgggggccagtggaatcagaacttctgctcaac
cgggatggccgtcgttggagaagactttaa

DBGET integrated database retrieval system