KEGG   Planktothrix agardhii: NIES204_32360Help
Entry
NIES204_32360     CDS       T05658                                 

Gene name
rbcS
Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
pagh  Planktothrix agardhii
Pathway
pagh00630  Glyoxylate and dicarboxylate metabolism
pagh00710  Carbon fixation in photosynthetic organisms
pagh01100  Metabolic pathways
pagh01110  Biosynthesis of secondary metabolites
pagh01120  Microbial metabolism in diverse environments
pagh01130  Biosynthesis of antibiotics
pagh01200  Carbon metabolism
Module
pagh_M00165  Reductive pentose phosphate cycle (Calvin cycle)
pagh_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
pagh_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:pagh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    NIES204_32360 (rbcS)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    NIES204_32360 (rbcS)
Enzymes [BR:pagh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     NIES204_32360 (rbcS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: BBD55917
UniProt: A0A2Z6CHB2
Position
3636218..3636553
Genome map
AA seq 111 aa AA seqDB search
MRTLPKERRFETLSYLPPLTDAQIVKQVQYILDQGYIPGVEFSESSEPTQHYWTLWKLPL
FNATTSQEVLNEVQACRQENSKSYIRVMGFDNVKQCQVLSFIVHKPSSSLY
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atgcggacattaccaaaagaacgtcgttttgaaacgttatcctatcttccccccttgacc
gatgctcaaatcgtcaagcaagtccaatatattctggatcaaggatatatccccggtgtg
gagtttagcgaatcttccgaacccacccaacattattggacgctgtggaaactgccttta
ttcaatgccactacttctcaagaagttttgaatgaagttcaagcttgccgccaagaaaat
tctaaatcctatatccgtgtgatgggttttgataacgtgaagcaatgccaagtgttaagc
ttcatcgtccacaaacccagtagctctttatactaa

DBGET integrated database retrieval system