KEGG   Porphyromonas asaccharolytica: Poras_0491Help
Entry
Poras_0491        CDS       T01485                                 

Definition
(GenBank) hypothetical protein
  KO
K01057  6-phosphogluconolactonase [EC:3.1.1.31]
Organism
pah  Porphyromonas asaccharolytica
Pathway
pah00030  Pentose phosphate pathway
pah01100  Metabolic pathways
pah01110  Biosynthesis of secondary metabolites
pah01120  Microbial metabolism in diverse environments
pah01130  Biosynthesis of antibiotics
pah01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pah00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Poras_0491
Enzymes [BR:pah01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.31  6-phosphogluconolactonase
     Poras_0491
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucosamine_iso
Motif
Other DBs
NCBI-ProteinID: AEE12445
UniProt: F4KNH4
Position
592215..592952
Genome map
AA seq 245 aa AA seqDB search
MNYHQYSTPELVTTQLAQFIAEAVEATEGDFHLALSLEEHAEVLAQALTSEPWRSRIAWD
RVHFYLLHEQLGEADLAHRTLLQRLLFDPLQIPAEHIHAVEESAQEPAQAAASLQQHVAE
RVSHLDGRPQFDLALLEMGVDGHLAGVYPDQVELYISDDVFAPNEMTTEQGEQRQLVTVT
LEALEESKRLVFLALGQDVRHAVGHIVNLLPEAKAYPANFLAAKIPWVHLFADDQAMREK
SYAIY
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgaactatcatcaatacagtacccccgagctagtcacgacacagctcgcacagtttatt
gccgaagcggtcgaggcgaccgaaggcgactttcatctagcactctcattggaagagcat
gcggaggtcttggcacaggcactcacgtcagagccttggcgtagtcgtatcgcatgggat
cgagtacacttctacctacttcacgagcagctgggcgaagccgatctagcgcatcgcacg
ctgctacagcgtctgctattcgatccgctacagatccctgcggagcatatccacgctgtg
gaggagtctgcacaagagcccgcacaggctgcggcctctctgcagcagcatgtagcggag
cgtgtaagccatctagacggtcgtccgcagtttgacctagccctcctcgagatgggtgtg
gatggtcacctcgctggggtctatcccgaccaggtggagctgtatatctcggacgacgtc
tttgcacccaatgagatgaccaccgagcaaggggagcagcgtcagctggttacggtcacg
ctcgaggcacttgaagagtctaagcgactggtcttcctcgcactcggtcaggacgtgcgc
cacgcggtgggacacatcgtcaatctcttgcccgaggcgaaagcttatcctgctaacttc
ctcgcggcgaagataccttgggtacatctctttgccgatgatcaggccatgcgtgagaag
tcttacgcgatctattaa

DBGET integrated database retrieval system