KEGG   Porphyromonas asaccharolytica: Poras_0909Help
Entry
Poras_0909        CDS       T01485                                 

Definition
(GenBank) Peroxiredoxin
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
pah  Porphyromonas asaccharolytica
Pathway
pah00480  Glutathione metabolism
pah00590  Arachidonic acid metabolism
pah01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pah00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    Poras_0909
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Poras_0909
Enzymes [BR:pah01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Poras_0909
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin Phosphonate-bd
Motif
Other DBs
NCBI-ProteinID: AEE12852
UniProt: F4KKC7
Position
1140774..1141259
Genome map
AA seq 161 aa AA seqDB search
MATIYDFTALTSQGKELNLADLRGKVILIVNTASKCGYTPQLAGLEELHKQYHDKGLVLL
GFPCNQFGGQDPGTDEEIRDFCQVNYGVTFQIMQKVEVNGPHAHPLFKFLKEETSQDSDL
PVKPIQWNFNKFLISRDGTDITRYGSAKLPKNLAKDIEALL
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atggcaactatatacgacttcaccgccctgacctctcagggcaaggagctaaacttagcc
gacctacgcggcaaagtcatcctcatcgtcaataccgcgagcaagtgcggctacacgcct
cagctggctgggctcgaggagctacacaagcagtaccacgacaaggggctcgtcctgctc
ggcttcccttgcaatcagtttggcgggcaagaccctggcaccgatgaggagatacgagac
ttctgtcaggtcaactatggcgtcaccttccaaatcatgcagaaggtagaggtcaacggg
ccccacgcccacccgctctttaagttcctcaaggaggagacgagccaagactcagacctg
ccagtcaagccgatacagtggaacttcaacaagttcctcatctcccgtgacggcaccgac
ataacccgctacggatcggctaagctacctaagaacttagccaaggacatcgaagctctc
ctctaa

DBGET integrated database retrieval system