KEGG   Porphyromonas asaccharolytica: Poras_1170Help
Entry
Poras_1170        CDS       T01485                                 

Definition
(GenBank) methylaspartate ammonia-lyase
  KO
K04835  methylaspartate ammonia-lyase [EC:4.3.1.2]
Organism
pah  Porphyromonas asaccharolytica
Pathway
pah00630  Glyoxylate and dicarboxylate metabolism
pah00660  C5-Branched dibasic acid metabolism
pah01100  Metabolic pathways
pah01120  Microbial metabolism in diverse environments
pah01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pah00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Poras_1170
   00660 C5-Branched dibasic acid metabolism
    Poras_1170
Enzymes [BR:pah01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.2  methylaspartate ammonia-lyase
     Poras_1170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MAAL_C MAAL_N MR_MLE_C Enolase_C
Motif
Other DBs
NCBI-ProteinID: AEE13112
UniProt: F4KLG4
Position
1497473..1498774
Genome map
AA seq 433 aa AA seqDB search
MGVALFLAINSNNPINPNNMKIKKVVCAPGKTGFFFDDQKAIKKGAKNDGAFYSGDPVTP
GFTSVRQAGESISVLFILEDGSIAHGDCAAVQYSGAGGRDPLFLAESFIPVIMKEIAPLY
EGKEITTFRKMADLVDKHVNADGKKYHTAIRYGVTQACLDAVAKSQHKLMAQVVADEYGT
KISDTMVPIFSQSGDDRYLNVDKMIMKEVGVLPHALFNNVETKVGLKGEKIKEYLQWLRD
RIVTKRQNPNYQPAIHIDVYGTLSIVFNNDFQRIADYLNELSEIVAPFELRVEGPVDMDG
REPQIEALAKIRELLDAKGSKCQIVADEWCNTLEDIIAFSERKAGHMVQIKTPDLGGVNN
AIEAVLYCKQHNMRAYLGGTCNETNRSAEVCANIAMATSPCQCLAKPGMGVDEGYMIIFN
EMSRVLALKDVLK
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgggggtagcactatttctagcaatcaattctaacaatccaataaatcctaataatatg
aagatcaagaaggtagtctgtgccccaggcaagacaggattcttctttgacgaccagaag
gccatcaagaagggcgctaaaaatgatggagccttttactctggagaccccgtaacccca
ggctttacgtctgtacgtcaggctggtgagtctatctctgtcctctttatcctagaggat
ggttcgatagctcacggtgactgtgcagctgtacagtactcaggggctggtggtcgtgat
ccactgttcctcgccgagagctttattccagtcatcatgaaggagatcgctccgctctat
gagggcaaggagatcacgacgttccgcaagatggccgacctcgttgacaagcacgtcaat
gcagacggtaagaagtaccacacggcaatccgctacggtgtcacacaggcttgtctagat
gctgtcgctaagagccagcacaagctgatggcgcaggtagtcgctgatgagtatggtacg
aagatctctgacacgatggtgcccatcttctcgcagagtggcgacgaccgctatctcaac
gtcgataagatgatcatgaaggaggtaggcgtactgccacacgctctattcaataatgta
gagaccaaggtcggcctcaaaggtgagaagatcaaggagtacctccagtggctccgcgac
cgtatcgtcacgaagcgtcagaaccccaactaccagcccgctatccatatcgacgtatat
ggtacgctgagcatcgtcttcaacaacgacttccagcgcatcgctgactatctgaacgaa
ctctctgagatcgttgctcctttcgagcttcgtgtcgagggtcctgtagatatggacggt
cgtgagccacagatcgaggcactggctaagatccgtgagctacttgatgccaagggctct
aagtgccagatcgtcgctgatgagtggtgcaacacgctcgaggatatcatcgctttctct
gagcgcaaggctggacacatggttcagatcaagacgcctgacctcggtggtgtcaataat
gctatcgaggctgtcctctactgcaagcagcacaatatgcgcgcttatctaggtggtact
tgcaatgagaccaaccgctcagcagaggtttgtgccaatatcgctatggctacctctccc
tgccagtgcctagctaagcctggtatgggtgtcgatgagggatacatgatcatcttcaac
gagatgagccgtgtactcgctctcaaggatgtgctgaagtag

DBGET integrated database retrieval system