KEGG   Pyrobaculum aerophilum: PAE0944Help
Entry
PAE0944           CDS       T00073                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K01622  fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
pai  Pyrobaculum aerophilum
Pathway
pai00010  Glycolysis / Gluconeogenesis
pai00030  Pentose phosphate pathway
pai00051  Fructose and mannose metabolism
pai00680  Methane metabolism
pai01100  Metabolic pathways
pai01110  Biosynthesis of secondary metabolites
pai01120  Microbial metabolism in diverse environments
pai01130  Biosynthesis of antibiotics
pai01200  Carbon metabolism
pai01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pai00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAE0944
   00030 Pentose phosphate pathway
    PAE0944
   00051 Fructose and mannose metabolism
    PAE0944
  Energy metabolism
   00680 Methane metabolism
    PAE0944
Enzymes [BR:pai01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     PAE0944
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     PAE0944
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_3
Motif
Other DBs
NCBI-ProteinID: AAL63145
UniProt: Q8ZY51
Position
complement(548441..549640)
Genome map
AA seq 399 aa AA seqDB search
MKITVSIIKADVGGFPGHAHVHPKMLEYAAAKLKEAQRKGVIIDYFVYNVGDDISLLMTH
TKGEDNPDIHGLAWETFREITEQVAKKYKLYGAGQDLLKDAFSGNVRGMGPQVAEMEFDE
RPSEPLVVFAADKTEPGAFNLPLYKMFADPFNTAGLVIDPSMHEGFIFEVLDVVEHKVYL
LKTPEESYYLLGLIGTTGRYIIRKVFRRADGAPAAANSVERLSLIAGRYVGKDDPVMMVR
AQSGLPAVGEILEAFSHPHLVHGWMRGSHAGPLMPARFISVDPERRIAIGAKMTRFDGPP
KVGALGFQLHDGYLEGAVDLFDDPAFDYVRQVAAQIADYIRRMGPFQPHRLPPEEMEYTA
LPKILAKIKAYPADQYEKERRKYVEALVKGQKAEEAHHD
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcactgtatcaataattaaggccgatgtgggcggattcccaggacacgcgcac
gttcatcccaaaatgcttgaatatgcagcggcaaagttaaaagaggcccagagaaagggg
gtaataatcgattactttgtgtacaacgtgggagacgacatatctcttttaatgacgcac
acaaagggcgaggacaacccagacatacacggcctcgcgtgggagaccttcagggagata
actgaacaagtggccaagaagtacaagctgtacggcgccggccaggacttgttaaaagac
gccttctcgggcaacgtgaggggcatgggcccgcaggtggcggagatggagtttgacgag
aggcccagcgagcctctggtggtcttcgccgccgataagactgagccgggtgctttcaac
ctcccgctgtataaaatgttcgcagaccccttcaacaccgcgggtctcgtcattgatccc
tcaatgcacgaaggctttattttcgaagttctcgacgtagttgagcacaaggtataccta
ttaaaaactcctgaggagtcgtactacctactgggcctcattggcacaacgggcaggtac
ataatcaggaaggtgtttagaagggcggacggcgcccccgccgcggctaacagcgtggag
aggctgtcgcttatagccggcagatatgtcggcaaagacgaccccgttatgatggtaaga
gcccagtcgggccttcccgctgtgggggagatactagaggcgttttcgcacccgcattta
gtacacggctggatgagggggagccacgcggggcccttaatgccagcccgctttatttct
gtggacccagaaaggagaatagcaattggcgccaagatgactaggtttgacggaccgccc
aaagtaggcgccttgggctttcaactacatgacggctatttagaaggcgccgtggatctc
ttcgacgacccggcctttgactatgtgagacaagtcgccgctcagatagccgattatata
cgccgcatggggcccttccagccgcacagactcccgcccgaggagatggagtacacggca
ttgcctaaaatactggccaaaataaaggcgtatcctgcagatcaatatgaaaaggagagg
aggaagtacgttgaggccttagtgaagggacaaaaagcagaggaggcgcatcacgactag

DBGET integrated database retrieval system