KEGG   Pyrobaculum aerophilum: PAE1038Help
Entry
PAE1038           CDS       T00073                                 

Definition
(GenBank) D-3-phosphoglycerate dehydrogenase (serA)
  KO
K00015  glyoxylate reductase [EC:1.1.1.26]
Organism
pai  Pyrobaculum aerophilum
Pathway
pai00630  Glyoxylate and dicarboxylate metabolism
pai01100  Metabolic pathways
pai01110  Biosynthesis of secondary metabolites
pai01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    PAE1038
Enzymes [BR:pai01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.26  glyoxylate reductase
     PAE1038
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 F420_oxidored IlvN XdhC_C YAcAr
Motif
Other DBs
NCBI-ProteinID: AAL63218
UniProt: Q8ZXX8
Position
complement(608030..609001)
Genome map
AA seq 323 aa AA seqDB search
MPCIFVSREGFPESMYKKLEEVGRVEVYRHGGSPWSTRGVPKEVLIDAARRCEALVIFIG
DVIDKEVLDAGEKLKIVSTASVGVDHIDVEYAKRKGVVVAHTPYVLVDAVADLAVGLLIA
VTRKIALGDRLIRSGAADAVWGSLMGVNLRGKRAGIVGLGNIGVAIARRLKAFDIEVAYW
SRRRKPEVEFALGIEYMELDSLLSSSDFIFLTMALTPETRWFFNRERFAKVKRGAYFINV
ARGGLVDTDALIEALEAGVLAGAALDVFDVEPLPARHKLASMDNVVLTPHIGSATVETRR
RMAELAAENVVSFFRTGRPIYAV
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgccgtgtatattcgtgtcgcgcgagggatttcccgagtccatgtataaaaaacttgag
gaggtgggccgcgtcgaggtgtaccgccacggcggatctccctggtcaactaggggagtc
cccaaggaggttttaattgacgcggctaggcgttgtgaggcgctggttatcttcattgga
gacgtaattgataaagaggtattagacgccggggaaaagctgaagatcgtgtccacagcg
tctgtgggggtggaccacatcgacgtggagtacgccaagagaaagggcgtggtggtggcc
cacacgccttatgtcttagtagacgctgtcgccgatttggccgtcggcctcctcatcgca
gtgacgaggaaaatagccttaggcgaccgcctcatacggagcggcgccgccgacgctgtg
tgggggagtctcatgggagttaatctaaggggaaaaagggcgggtatcgtcggccttggc
aacatcggcgtggctattgcccgcaggcttaaggcctttgacatagaagtggcgtattgg
agcaggaggcgcaagccagaggtggagttcgccctggggattgagtatatggagctagac
tccctactgtcctccagcgacttcatattcttgaccatggccctcacacctgagacccga
tggtttttcaacagggagcgttttgctaaggtcaagaggggggcctactttataaacgtg
gcgaggggcgggctggtggatacagacgcccttattgaggccctggaggccggggttttg
gccggcgccgcccttgacgtattcgacgtggagcccctcccggcgcgccacaagctagcg
tctatggataacgtggtgttgactccgcacatcggctccgcgactgtggagacgaggcgc
cggatggcggagctcgccgccgagaacgtggtctcgttcttcaggacagggaggccgata
tatgcggtataa

DBGET integrated database retrieval system