KEGG   Pyrobaculum aerophilum: PAE1175Help
Entry
PAE1175           CDS       T00073                                 

Definition
(GenBank) 2-hydroxyacid dehydrogenase
Organism
pai  Pyrobaculum aerophilum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 NAD_Gly3P_dh_N F420_oxidored
Motif
Other DBs
NCBI-ProteinID: AAL63301
UniProt: Q8ZXP5
Structure
PDB: 

Position
687342..688247
Genome map
AA seq 301 aa AA seqDB search
MELYVNFELPPEAEEELRKYFKIVRGGDLGNVEAALVSRITAEELAKMPRLKFIQVVTAG
LDHLPWESIPPHVTVAGNAGSNADAVAEFALALLLAPYKRIIQYGEKMKRGDYGRDVEIP
LIQGEKVAVLGLGEIGTRVGKILAALGAQVRGFSRTPKEGPWRFTNSLEEALREARAAVC
ALPLNKHTRGLVKYQHLALMAEDAVFVNVGRAEVLDRDGVLRILKERPQFIFASDVWWGR
NDFAKDAEFFSLPNVVATPWVAGGYGNERVWRQMVMEAVRNLITYATGGRPRNIAKREDY
I
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atggaactgtacgtaaattttgaactcccgccagaggcagaggaggagttgaggaagtat
ttcaaaattgtcaggggaggcgatttgggcaacgtagaggcggcattagtgagcagaatt
acggcggaggagttggcgaaaatgccgaggcttaagtttatacaagtcgtcacggccggg
ctcgaccacctcccttgggagagcattccgccccacgttaccgtggccggaaacgccggc
tcaaacgcagacgcagtggccgagttcgccctcgcgctcttactagcgccttacaaacgg
attattcaatacggcgagaaaatgaagagaggggattacgggcgggatgtcgaaataccg
cttatccaaggggagaaagtggccgtattgggcttgggagaaatcggcacgagagtgggg
aaaatcctggcggccctcggggctcaggtcaggggcttttccaggacgcccaaggagggg
ccgtggcggtttacaaacagccttgaggaggccctccgggaggccagggcggctgtatgc
gccctcccgctcaataaacacaccagggggttggtaaaataccaacacttggccttaatg
gcggaagacgccgtgtttgtcaacgtgggcagggccgaggtgttagacagagacggggtg
ttgaggattttgaaggaaaggccgcagtttatcttcgccagcgacgtctggtggggcaga
aacgacttcgcaaaagacgccgagttcttctcattgcccaacgtagtggcaacgccgtgg
gtggcgggagggtatggtaatgagagagtgtggcgtcagatggtcatggaggctgtgagg
aatttaattacgtacgccacgggcgggcggccccgcaatatagccaagagagaagattat
atataa

DBGET integrated database retrieval system