KEGG   Pyrobaculum aerophilum: PAE2559
Entry
PAE2559           CDS       T00073                                 
Name
(GenBank) tetracycline resistance protein
Organism
pai  Pyrobaculum aerophilum
SSDB
Motif
Pfam: MFS_1 Sugar_tr MFS_4 MFS_2 TRI12 MFS_1_like
Other DBs
NCBI-ProteinID: AAL64278
UniProt: Q8ZUX8
Position
complement(1526457..1527542)
AA seq 361 aa
MRPIFTLLGVVAIHMLGFGIVIPVMPYVVKELGGGSEAYGVLVSIFSAVQMVSAPLWGAL
SDRIGRGPVITLGLALAAIGSAMAYGARSLAELALARAVSGMGGGTLGAVQALIADLSPP
ERRASNMALFGVAFGIGFILGPVVGGLLSVWGVRTPFIAAVIFSAAAAALSTSLPRVRGR
VGFSISLQFGAVAGLVLALNLAFSMFESMLVYYAADVFKMAPSDLGVLMLIIGLAVASAQ
PAVRRLEGRVAYTTSALAGFVATGAGIGVLPALGELGLYLGSAVAAVGQMVASSSLFALF
SQGERGRGIGFGALQSTASLGRIIGPSLAGWIYLKLGPSYVFYAAALLLLAASPAFWFWR
R
NT seq 1086 nt   +upstreamnt  +downstreamnt
atgcgcccaatatttacactgctcggcgtagtcgcaattcacatgctgggctttggaatt
gtcataccggttatgccctacgtagtgaaagagctgggaggcggatctgaggcatacggc
gtgctggtatcaattttctcagcggtacaaatggtctctgcgcctctctggggggcgctt
tcagatagaatcggcagggggcctgtgattactctggggctggcgctagcggctataggt
agcgcgatggcgtacggcgccaggagtcttgcagagctggcgctggcgagggcggtgtct
ggcatgggcggggggacccttggggccgtccaagcgctaattgcggatttaagcccgcct
gaaaggagggctagtaacatggccctcttcggcgtggcctttggcattggctttatacta
gggcccgttgtggggggattgctctccgtatggggcgtgaggacgccatttatagccgct
gttatattctcggccgctgccgccgccttgtctacctcactgccaagagtgagggggagg
gtggggtttagcattagcttacaattcggcgccgtagccgggttagtcctggcgcttaat
ctggccttctcaatgttcgagtccatgctggtgtattacgccgcggatgtgttcaaaatg
gctcccagcgatctgggcgttttgatgttaataattggcctggcggtagcctcggcacaa
cccgccgtgaggagattagaggggagagtggcgtacaccacatcggcgctggcgggcttt
gtggccacgggggcgggtataggagtgctacccgcgctgggagagctaggcctttatctt
ggatctgcggtggccgctgttggtcagatggttgcctcttccagccttttcgcccttttc
tcccagggggagaggggccggggcatcggctttggggccttacaatcaacggcgtcgctc
gggcgaattataggcccttctctcgccggctggatttacttaaagctgggccccagttat
gtcttttacgccgctgcgttgttgttattagccgcatccccggccttttggttctggcgc
aggtaa

DBGET integrated database retrieval system