KEGG   Pyrobaculum aerophilum: PAE2594Help
Entry
PAE2594           CDS       T00073                                 

Definition
(GenBank) uroporphyrinogen-III synthase (hemD), conjectural
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
pai  Pyrobaculum aerophilum
Pathway
pai00860  Porphyrin and chlorophyll metabolism
pai01100  Metabolic pathways
pai01110  Biosynthesis of secondary metabolites
pai01120  Microbial metabolism in diverse environments
Module
pai_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:pai00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PAE2594
Enzymes [BR:pai01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     PAE2594
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 ANF_receptor BetR
Motif
Other DBs
NCBI-ProteinID: AAL64304
UniProt: Q8ZUV2
Position
complement(1545137..1545958)
Genome map
AA seq 273 aa AA seqDB search
MKVEYIEGVGKWTVIITSGRPSKAELLAKLIIKAGGEPVYLPTVKVEESGSDISTVIGHL
TWSQAVLFMTGQSAWGLAELAKRAQRLEEVRTLLSQRELLCRGMKASGNVKTHFHLECPN
YGETSDELLVRAAEALRGKRLVVSFYGAVDSELLEELRKIAADVKYVQVYTTEEAPEANA
LEAARRFLEGNHILIFTSALGAEAFLKAVERAGILREVVETANSGRSVIAVVGPVTEQEV
RKYGVTRVIVPEKPFLAYLAEAVAEFLNKALDK
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtagaatatatagagggcgtgggcaagtggacggtgattatcacgtcggggagg
ccctccaaggccgagctgttggccaagctcataataaaggcggggggagagcccgtatac
ctaccaacggttaaagtggaggagagcggtagcgatatcagcactgtcataggccatttg
acgtggtcacaagccgtgttattcatgaccggccaatcggcgtggggtctcgccgagctg
gccaaaagggcgcagaggcttgaggaagtgaggacgctcctctcgcagagggagctcctc
tgcaggggaatgaaggcctctggcaacgtcaagacgcacttccaccttgagtgccccaat
tacggcgagacctccgacgagttgctcgtaagagcggcagaggcgctgagggggaagagg
ctggtggtgtcgttctacggcgctgttgactcagagcttctggaggagttgaggaaaatc
gccgctgacgtcaaatacgtccaggtctacacaacggaggaggcccccgaggcaaacgcc
ttggaggcggcgaggaggtttttagaggggaatcacatacttattttcaccagcgccctg
ggggccgaggcctttctcaaagccgttgagcgcgccggcattttgcgcgaagtggtggag
acggcgaattcggggaggtcagttatagcggttgtgggccccgtgactgagcaagaggtg
aggaaatacggcgtcacgagggttatagtccccgagaagccctttttagcctatctggcc
gaggctgttgccgagttcctcaacaaggcgcttgacaaataa

DBGET integrated database retrieval system